KEGG   Setaria italica (foxtail millet): 101757191Help
Entry
101757191         CDS       T02818                                 

Definition
protoporphyrinogen oxidase, chloroplastic-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101757191
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101757191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 535 aa AA seqDB search
MVAAAMATAPSAGVPPLRGTRGPARFRIRGVSVRCAAVAGGAAEAPASAGARVSADCVVV
GGGISGLCTAQALATKHGVGDVLVTEARARPGGNITTVERPDEGYLWEEGPNSFQPSDPV
LTMAVDSGLKDDLVFGDPNAPRFVLWEGKLRPVPSKPADLPFFDLMSIPGKLRAGFGALG
IRPPPPGREESVEEFVRRNLGAEVFERLIEPFCSGVYAGDPSKLSMKAAFGKVWRLEEAG
GSIIGGTIKTIQERGKNPKPPRDPRLPTPKGQTVASFRKGLAMLPNAITSSLGSKVKLSW
KLTSITKSDGMGYVLVYETPEGVVSVQAKSVIMTIPSYVASDILRPLSSDAADALSRFYY
PPVAAVTISYPKEAIRKECLIDGELQGFGQLHPRSQGVETLGTIYSSSLFPNRAPAGRVL
LLNYIGGATNTGIVSKSASELVEAVDRDLRKMLINPSAVDPLVLGVRVWPQAIPQFLVGH
LDLLEAAKSSLDRGGYDGLFLGGNYVAGVALGRCVEGAYESASQISDFLTKYAYK
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccgccgccatggccaccgccccctccgctggcgtgcctccactaagagggacc
cgcggccccgcgcgtttccgcattcgcggcgtcagcgtgcgctgcgccgcggtggcgggc
ggcgcggccgaggcgccggcctccgcgggcgcgcgggtgtccgcggactgcgtcgtggtg
ggcggcggcatcagcggcctctgcaccgcgcaggcgctggccacgaagcacggcgtcggc
gacgtgctcgtcacggaggcccgcgcccgacccggcggcaacatcaccaccgtcgagcgc
cccgatgaagggtacctctgggaggaggggcccaacagcttccagccctccgaccccgtc
ctcaccatggccgtggatagcgggctgaaggatgacctcgtgtttggagacccgaatgcg
ccgcggttcgtgctgtgggaggggaagctgaggcccgtgccatccaagcccgccgacctc
ccgttcttcgatctcatgagcattcctggcaagctcagggctggctttggggccctcggc
atccgaccgccacctccaggccgcgaggagtcagtggaagaattcgtgcgccgcaacctc
ggagctgaagtctttgagcgcctcattgagcctttctgctcaggtgtctatgctggtgat
ccttcaaagctcagtatgaaagctgcatttgggaaggtgtggcgcctagaagaggctgga
ggtagtattattggtggaaccatcaagacgattcaggagaggggcaagaatcctaaacca
ccgagggatccccgccttcctacgccaaaggggcagacagttgcatcttttaggaagggt
ctcgccatgcttccaaatgccattacatccagcttgggtagtaaagtcaagctttcgtgg
aaactcactagcattacaaaatcagatggcatgggatatgtattggtgtatgaaacacct
gaaggcgttgtttcagtgcaggctaaaagtgttatcatgacgattccatcatatgttgct
agtgacatcttgcgtccactttcaagcgatgctgcagatgccctttcaagattctattat
ccaccagttgctgctgtaactatttcgtatccaaaggaagctattagaaaggaatgcttg
attgatggggagctccagggttttggccagttgcatccacgtagtcaaggagttgagaca
ttagggacgatatacagctcatcactctttccaaatcgcgctcctgctggaagggtgtta
cttctaaactacataggaggtgccacaaacacaggaattgtttccaagagtgcaagtgag
ctggtagaagcagttgaccgtgacctcaggaaaatgctcatcaaccctagcgcagtggac
cctttagtcctgggtgtccgagtgtggccacaagccatacctcagttcctggtaggacat
cttgatcttttggaggctgcaaaatcttccctggaccgaggtggctatgatgggctgttc
cttggagggaactatgtagcaggagttgccctgggccgatgcgtggagggtgcctatgag
agcgcctcgcaaatatctgatttcttgaccaagtacgcctacaagtga

DBGET integrated database retrieval system