KEGG   Setaria italica (foxtail millet): 101757574Help
Entry
101757574         CDS       T02818                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 3
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101757574
   00500 Starch and sucrose metabolism
    101757574
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101757574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
IX
AA seq 582 aa AA seqDB search
MAIRAWTWVVLLLLALLPSCRAAEAPSPQPSADPELAVDDGLRTGYHFQPPKHWINDPNG
VMYYKGVYHLFYQYNPKGAVWGNIVWAHAVSTDLVDWIMLPPAIYPTAPFDVNGCWSGSA
TVLPDGTPVIMYTGIDGENRQVQNVAYPKDLSDPYLREWVKPDYNPVIAPGPGMNATAFR
DPTTAWQGPDGLWRLVIGTKDNHRGLAVLYRSRDFKRWAPAKRALHSGDTGMWECPDFYP
VTTSPAVGSGGGGSGNGTKHVLKVSLDLTRFEYYTFGEYDHATDTYVPDAALADGNDGLR
YDYGNFYASKTFLDTAKQRRVLWGWANESDSATADIRKGWAGVQAIPRKIWLSSDGKQLV
QWPVAEIESLRGAHANVTDTLVAGGSHFEVTGLASAAQADVEASFQVMDLDKAEPFDPAW
RGADAQTVCAARGADARGGVGPFGLWALASDEHGERTAVFFRVFKGGDGGKHVVLMCNDP
SMSSHADDLYKPTFAGFVDVDIAQTGGKIALRTLIDHSVVESFGAHGKTCILSRVYPTKA
VGDKARLYVFNNGESDVKVTHLNAYEMRSAKITSDAVEPTKR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcagggcttggacgtgggtggttctcctgttgctcgcgctgcttccgtcgtgc
cgcgcagcggaggcgccatcgccacagccgtccgccgaccccgagctcgccgtcgacgac
gggctccgcaccggctaccacttccagcctcccaagcactggatcaatgatcctaatggc
gtgatgtactacaagggcgtgtaccacctgttctaccagtacaaccccaagggcgcggtg
tggggcaacatcgtgtgggcgcacgccgtgtcgacagacctcgtcgactggatcatgctc
ccgccggcgatctacccgacggcgccgttcgacgtcaacggctgctggtcgggctccgcc
accgtgctcccggacggcacgccggtcatcatgtacaccggcatcgacggcgagaaccgg
caggtgcagaacgtggcctaccccaaggacctctccgacccgtacctccgggagtgggtc
aagcctgactacaaccccgtcatcgcgccggggccggggatgaacgccaccgcgttccgc
gacccgacgacggcgtggcagggccccgacgggctctggcgcctggtgatcggcaccaag
gacaaccaccggggactcgccgtgctctaccgcagcagggacttcaagcggtgggcgcca
gccaagcgcgcgctccactccggcgacaccggaatgtgggagtgcccggatttctacccc
gtgacgacttccccggccgtcggcagcggtggcggtggcagcggcaacggcacgaagcac
gtgctcaaggtgagcctcgacctgacgcggttcgaatactacacgttcggcgagtacgac
cacgccaccgacacatacgtgccggacgcggcgctcgccgacggcaacgacgggctccgc
tacgactacggcaacttctacgcgtccaagacgttcctcgacacggcgaagcagcggcgc
gtcctgtggggttgggccaacgagtcggactccgccaccgccgacatccgcaagggctgg
gccggcgtgcaggccatcccgaggaagatctggctctcttcggacggcaagcagctcgtg
cagtggccggtcgccgagatcgagtccctccgcggcgcccatgctaacgtcacggacacg
ctcgtcgccggcggcagccacttcgaggtcacagggctcgcgtcggcggcgcaggccgac
gtggaggcgtcgttccaggtgatggacctggacaaggcggagccgttcgacccggcatgg
cgcggcgcggacgcgcagacggtgtgcgcggcccgcggcgcggacgccaggggcggcgtc
gggccgttcgggctgtgggcgctcgcgtccgacgagcacggggagcgcaccgccgtgttc
ttcagggtgttcaagggcggcgacggcggcaagcacgtcgtgctcatgtgcaacgacccg
tccatgtcgtcgcacgccgacgacctctacaagccgaccttcgccggcttcgtcgacgtc
gacatcgcccagaccggcggcaagatcgctcttaggactctgattgaccactcggtggtg
gagagcttcggcgcgcacggcaagacgtgcatcctgtcgagggtgtacccgaccaaggcc
gtcggcgacaaggcgcgcctctacgtgttcaataacggcgagtcggacgtcaaggtcacc
cacctcaacgcgtacgagatgcggtcggcgaagatcaccagcgacgcggtggaaccgacg
aagagatga

DBGET integrated database retrieval system