KEGG   Setaria italica (foxtail millet): 101757589Help
Entry
101757589         CDS       T02818                                 

Definition
probable pectinesterase 53-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101757589
   00500 Starch and sucrose metabolism
    101757589
Enzymes [BR:sita01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101757589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 403 aa AA seqDB search
MAVGNGARRRCHHGTAMPMPRARFLACIAVAVVALLAPPCGVAGHSRGMRPGRGGGGSAA
PFPANATRAEMIERQFMEWVRYMGALRHSTFQHALARAFPSYSLVVDKNPAFGDFTTIQA
AIDSLPAINLVRVVIRVNAGTYTEKVTISAMRAFITLEGAGADSTIVQWGDTADSPTGPK
GRPLGTFNSATFAVNAQYFLARNITFKNTSPVPKPGATGKQAVALRVSADNAAFVGCKFL
GAQDTLYDHSGRHYYKECYIEGSVDFIFGNALSLYEDCHVHAIARDYGALTAQNRQSMLE
DTGFSFVNCRVTGSGALYLGRAWGTFSRVVFAYTYMDNIIIPRGWYNWGDPNRELTVFYG
QYKCTGPGASYAGRVAWSRELTDDEAKPFISLSFIDGTEWVRL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgggtaacggcgcgcggcggcgttgccatcacggcaccgcaatgcccatgcca
cgcgcgcgattcttggcctgcattgccgtggcggtcgtggcgctcctcgcgccgccgtgc
ggagtggccgggcactcgcgcgggatgcggccggggcgcggcggcggcggctcggcggcg
ccgttcccggcgaacgcgacgcgggcggagatgatcgagcggcagttcatggagtgggtg
cggtacatgggggcgctccggcacagcacgttccagcacgcgctcgcccgcgccttcccg
tcctactcgctcgtcgtcgacaagaacccggcgttcggcgacttcacgaccatccaggcc
gccatcgactcgctcccggccatcaatctcgtccgcgtcgtcatcagggtcaacgccggc
acctacacggagaaggtgaccatctcggcgatgcgcgcgttcatcacgctggagggcgcc
ggcgcagacagcacgatcgtgcagtggggcgacaccgcggactcgccgacggggcccaag
gggcggcccctcggcacgttcaactcggcgacgttcgccgtgaacgcgcagtacttcctc
gccaggaacatcactttcaagaacacgtcgccggtgccgaagccgggcgcgacggggaag
caggcggtggcgctgcgggtgtcggcggacaacgcggcgttcgtggggtgcaagttcctg
ggcgcgcaggacacgctgtatgaccactccggccggcactactacaaggagtgctacatc
gaagggtccgtggacttcatcttcggcaacgcgctctcgctgtacgaggactgccacgtg
cacgcgatcgcgcgggactacggggcgctgacggcgcagaaccggcagagcatgctggag
gacacggggttctcgttcgtcaactgccgggtgacggggtcgggggcgctctacctgggt
cgcgcctggggcaccttctcccgcgtcgtcttcgcctacacctatatggacaacatcatc
atcccgcgcgggtggtacaactggggcgaccccaaccgcgagctgacggtgttctatggg
cagtacaagtgcacgggcccgggcgcgagctacgccggccgggtggcgtggtcgcgcgag
ctcaccgacgacgaggccaagccgttcatctcgttgagcttcatcgatgggaccgagtgg
gtcaggctgtaa

DBGET integrated database retrieval system