KEGG   Setaria italica (foxtail millet): 101760993Help
Entry
101760993         CDS       T02818                                 

Definition
probable histone acetyltransferase HAC-like 1-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101760993
Transcription factors [BR:sita03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101760993
Mitochondrial biogenesis [BR:sita03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101760993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1722 aa AA seqDB search
MNVGQAAHLSGQMSGQAAQMNQVANSGVGVGVGGADGLQQHQPMQDMASLTGTDQQFVML
RTTMRDRIFECLGRKQLSAEWRKRLPELAKRLEEMLFRKFPNRNEYYNMMNGPVEPQLQF
AIKTLSAQNQQNQQNPQMSRQIASSSGYGTMIPTPGMTQGTSGNSRVPYVSDNNTLSSSG
AGMVPQNANMGTSMPGSMSNGYQHSNNTITQNSTPNSIQSAMGSVGVQRQLPHMIPTPGF
SNQQNVPVNPEYSNGTGYFNGDSAVAPHMQHQKQFSSNQNSNQIQHIGGHSNSGIHSSML
DNSSAYGLSDGHMNGGIGLHGSNMQLTNRTTAPEAYMNIPPYGSSPKPLQQQFNQRSQQR
IPTSVDMAGSGSFYATGSTPLTTANSQSMNVANLQSRSRMNPMLVNNQLNIQSIQPQPQI
KTEVLDQPEKVNFQSSQLTHDQLIRQHSMPQHQVQPNSQFVQNQYHISQQQPNPQHQQAM
LRSNSFKQSQMASSHSMQLSEQGTLPHTELVSSQASDPVDIPSFQGQYQQRNALDNVKGG
QMFGHLSGSQNFHASASHGSQQLLPSNPQLDDGSNDVSYVLKGSQTEQILRPQWQPQTTE
KAPVTTNSSLEKQIHEDFCQSTMAQDGVQQPFSSDWRLSHCTVTSIDPAVPKPLAGGFEQ
VTGNIHYLRQIRWLLLLFHAKSCTYPVGSCKFHGCVQVQELLKHFQNCQRKDCSYRSCSR
SKMVSHHYKTCVDEQCPVCSVVRKFLRQSTEQAAKQKALESRKLAQQNVTQRIMNGVEGD
RMDVDPVSAEVFDDQPSVPKRLKMQPPSPSAPANDISLTSNPHVNPGFVLQETQPELEHS
NRATYPKREVDIKADMRAPQKPIKIGYGIDGNVTTRHNMISGVPNEMNSHIKQENLSIDK
ETSETALEVKNETDDPADATVSKSGKPKIKGVSLTELFTPEQIKEHIDSLRLWVGQSKAK
AEKNQAIGHSENENSCQLCRVEKLTFEPPPIYCSPCGARIKRNAPYYTVGTGDTRHYFCI
PCYNESRGETIEVEGQAFLKAKLEKKRNDEETEEWWVQCDKCECWQHQICALFNGRRNDG
GQAEYTCPNCYVEEVKCGLRKPLPQSAVLGAKDLPRTVLSDHIEDRLFKRLKQEKQDRAA
AAGKNIDEIPGAEGLVVRVVSSVDKKLEVKSRFLEIFSKDNYPKEFPYKSKAVLLFQKIE
GVEVCLFGMYVQEFGAECSFPNQRRVYLSYLDSVKYFRPEIKTVSGEALRTFVYHEILIG
YLEYCKQRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLRKASKEEIV
VELTNLYDHFFITMGECKAKVTAARLPYFDGDYWPGAAEDMITQLLQEEDDRKLQKKSKT
KKIITKRALKAAGHTDLSGSASKDAMLMQKLGETIYPMKEDFIMVHLQYSCSHCCILMVS
GRRWVCHQCRSFYICDKCYDAEQQLEDRERHPSNSRDTHMLHPVDIVGVPKETKDRDDIL
ESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNVCCHDIET
GQGWRCEVCPDFDVCNACFQKGAVNHPHPLTNHPSAADRDAQNAEARQMRVQQLRKMLDL
LVHASTCRSGSCQYPNCRKVKGLFRHGMQCKTRASGGCVLCKKMWYMLQLHARACKDADC
NVPRCRDLKEHLRRLQQQSDSRRRAAVNEMMRQRAAEVAANE
NT seq 5169 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtggggcaggctgcccacctgtccgggcagatgtccgggcaggcagcgcagatg
aatcaggtcgccaacagcggtgtcggcgttggtgttggcggtgccgacgggctccagcag
caccagccgatgcaggatatggcgtccctcacaggaacagaccagcagtttgtcatgcta
cgcaccactatgcgcgataggatattcgagtgtctaggaaggaaacaattatcagctgag
tggcggaagcggttgccggaactggcgaagcggctcgaggagatgctgtttaggaaattc
ccaaataggaatgaatactacaatatgatgaatggaccagttgagccacaattgcaattt
gctattaagaccctgagtgctcagaaccaacaaaatcaacaaaacccacaaatgtcaagg
caaatagcatcttcctctggctatggaacgatgattccaacacctggtatgacacaaggc
accagtggaaattctagggttccttatgtctcagacaacaatactctttcatcatctggt
gcaggcatggttcctcagaatgccaacatgggtacctcgatgccaggctctatgtctaac
gggtaccagcattcaaataacaccattacacaaaattctaccccaaatagcatccaatca
gcaatgggttcagttggtgttcagcgacaactacctcatatgatcccaactccaggattc
agtaatcaacagaatgtacctgtcaatcctgagtattcaaatggaactggatatttcaat
ggtgattcagctgtggcaccacatatgcagcaccagaagcaattttctagcaaccaaaat
agcaatcaaattcagcacattgggggccacagtaattctggaatacattcaagcatgctg
gacaactcatctgcatatggtttatcagatgggcacatgaatggtggaattggattgcat
gggtcaaacatgcagctaacaaacaggactacggcaccagaagcatatatgaacataccc
ccctatggcagttcgcccaaacctctgcagcaacaattcaatcagcgctctcagcagaga
ataccgacatcagttgatatggctggttccggcagcttttatgctactggctctacacct
ttaaccacagcaaatagtcagagcatgaatgttgcaaatttgcagtctagatcaagaatg
aatccaatgttggttaacaatcagttaaacattcagtccattcaaccacagcctcagata
aaaactgaggttttggatcaaccagaaaaggtgaattttcagtcatcacagttgactcat
gaccaactaatacgccagcactcaatgccgcaacatcaggtgcagcctaattcccagttt
gttcaaaatcagtatcatataagtcaacagcagccaaatccacagcatcagcaggctatg
ctgaggagcaattcctttaaacagtctcaaatggcttccagccattcaatgcaactgtca
gaacaggggactctgccacacactgaattggtatcttcacaagctagtgatcctgttgat
attccaagcttccagggtcaataccagcaaagaaatgctcttgacaatgttaaaggaggg
cagatgtttggtcatctatccggctctcaaaattttcatgcttctgcctcacatggttca
cagcaattgttgccctctaatccgcagcttgatgacggttccaatgatgtaagctacgtg
ctgaaaggatcacagacagagcaaattctgcggcctcagtggcagccacaaacaacggaa
aaggctcctgtgactactaattcatcacttgaaaagcaaatacatgaagatttttgtcaa
agtaccatggcccaggatggggtgcaacaaccattttcatctgattggcgtctttctcat
tgcactgtgacttcaattgatcctgcagtgccaaagcccctagctggaggatttgagcag
gtcactggaaatatccattacctccgtcagataaggtggttgctgttactgtttcatgca
aaatcatgcacatatcctgttgggagttgtaagttccatggctgtgttcaggtgcaagag
cttttgaagcattttcagaactgtcaaagaaaagattgttcgtacaggagctgcagtagg
tcaaaaatggtgtctcaccattataaaacttgtgtcgatgagcagtgtcctgtatgcagc
gttgtaaggaagtttttgcgccaatcaactgaacaggcagctaagcaaaaagctcttgag
tctagaaaacttgctcaacaaaatgtgacccaaagaatcatgaatggggtagaaggtgat
agaatggatgttgacccagtgtcagctgaagtatttgatgatcaaccatctgtaccaaaa
cgtttgaaaatgcagcctccatcacccagtgctccagcgaatgatatctctctaacctcc
aatcctcatgtaaacccaggctttgtactgcaggaaacacagcctgagcttgagcacagt
aacagagcaacatatccgaaacgggaggtagatataaaggctgacatgcgagctccgcaa
aagcccataaaaattggttatggtattgatggaaatgtgactacaaggcataatatgatt
agtggtgttcccaatgagatgaactctcatatcaagcaagaaaacttgtccattgataaa
gagacaagtgaaacggctcttgaggttaagaatgaaacagatgatccagcagatgccaca
gtgtctaaatcaggaaaaccaaaaataaaaggtgtctcattgactgaattgttcactcca
gagcaaataaaggaacatattgacagtctgaggttgtgggttggtcagagtaaggctaaa
gctgaaaagaatcaagctattggtcactctgagaatgagaactcttgccagctctgtaga
gtggagaaacttactttcgaacctccaccaatatattgttctccttgtggagctcggata
aagcgaaatgcaccatactacactgtaggtactggtgatacacgccattatttctgtatc
ccttgttacaatgagtctcgtggtgagactattgaggttgagggccaagcatttttgaag
gccaaattagagaaaaaaagaaatgatgaggaaacggaagaatggtgggttcagtgtgac
aagtgcgaatgctggcaacatcaaatttgtgctctatttaatggcagaagaaatgatgga
ggacaagctgaatatacttgccccaattgctatgttgaggaggtgaaatgtgggctacgc
aagcctttaccacagagtgctgttcttggggcaaaagacctgccaagaactgttcttagt
gatcatatagaagatcggctctttaaacggcttaagcaggagaaacaggaccgtgcagct
gctgccgggaaaaatattgatgagattcctggagcggaaggtcttgtggtcagagttgtt
tcatctgtggataagaagctggaggttaaatcacgttttttggaaattttttcaaaagac
aactaccctaaggagttcccttacaagtccaaggctgttctcttgttccagaaaatagaa
ggtgtggaagtatgcctatttggaatgtatgttcaagaatttggtgcagagtgctctttc
ccaaaccagcgccgtgtttatttgtcatacttggattctgttaagtacttcagacctgag
attaaaacagtgtctggagaggccttacgtacattcgtgtatcatgaaattctgatagga
tatcttgaatactgtaagcagcggggattcacaagctgttacatatgggcttgcccacct
ttgaagggtgaagattacatcttatattgccatcctgagattcaaaagactccaaaatct
gacaaactgcgtgagtggtacttggccatgctgcgtaaagcttctaaggaggaaattgtt
gttgagctgaccaatctctatgatcatttcttcattactatgggggaatgcaaggcgaag
gtgactgctgctcgcttgccgtactttgatggagattattggccaggagctgcagaagat
atgatcactcaactccttcaagaagaagatgaccgcaagcttcagaagaagagtaagaca
aagaagattattacaaaaagagctcttaaagctgctggccacacagatctcagcgggagt
gcttccaaggatgctatgctgatgcaaaagcttggtgaaaccatatatcctatgaaggaa
gatttcattatggtccatttacagtattcatgtagtcattgctgtatccttatggtgtca
ggaagacgttgggtttgccatcaatgcagaagcttttacatctgtgacaagtgttatgat
gcagaacaacaacttgaagacagggagaggcacccgagtaacagtagagacacacatatg
ctccatccggttgatattgtcggggtgcctaaagaaacaaaagatagagatgacatcttg
gaaagtgagtttttcgacaccaggcaggcatttctcagtctttgtcaaggaaaccattat
cagtatgacacacttcgccgtgcgaagcattcatcaatgatggtgttgtaccacctacac
aatccaactgcaccagcatttgtcactacatgcaatgtctgctgtcatgatattgaaact
ggtcaaggctggcggtgtgaagtttgtccagatttcgatgtgtgcaatgcttgtttccaa
aagggagcggtcaatcatcctcacccgttaacaaaccatccatcagctgcagaccgtgat
gcccaaaatgcagaagctcggcaaatgcgtgttcaacagctaaggaagatgcttgatctt
ctggtacatgcatcgacatgccgctctggtagttgccagtatcctaactgccggaaagtc
aagggactattccgccatgggatgcaatgcaaaacacgtgcttcaggagggtgtgtcctt
tgcaagaaaatgtggtacatgcttcaactccatgcccgagcttgcaaagatgcagattgc
aatgtgccgcggtgcagggatctcaaggagcaccttagaaggttgcaacagcagtctgat
tccaggaggagggctgctgtaaatgaaatgatgaggcaaagagcggcggaagtcgccgca
aatgagtag

DBGET integrated database retrieval system