KEGG   Setaria italica (foxtail millet): 101761744Help
Entry
101761744         CDS       T02818                                 

Definition
beta-amylase 3, chloroplastic-like
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sita00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 557 aa AA seqDB search
MALTLRSTTSFLSPVDPNSKLLHKPGADDAPPSCAAVPAPSHAAAPSRRLRLVRAAAAAA
PAPAMDRAPAEAAELLHGGAAGQDHGRPRGGVPVYVMLPLDTVGPGGQLSRQRAVAASLM
ALRGAGVEGVMVDVWWGVVEREGPGRYDWEAYAELVRMVERAGLRLQAVMSFHQCGGNVG
DTCNIPLPPWVLEEMSSNPDIVYTDRSGRRNPEYISLGCDTLPVLKGRTPIQVYADYMRS
FHDRFRDYLGNVIAEIQVGMGPCGELRYPSYPEANGTWRFPGIGEFQCYDKYMRASLEAA
AVAAGHEEWGRGGPHDAGEYKQMPEETGFFRRDGTWSTEYGQFFLEWYSGMLLEHGDRVL
AAADAVFGGTGATLSAKVAGIHWHYGTRSHAAELTAGYYNTRHHDGYAPIARMLAKRGAV
LNFTCMEMKDEQQPQHASCSPEQLVQQVKAAASAAGVELAGENALERYDEAAFSQVVSTA
RGAGLAAFTYLRMNKALFDGDNWREFVSFVRAMADGGARPALPRCDTGHSDLYVGFLDAA
KERKAPEAEGAATAVAL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcacgctgcgttccaccacgtccttcctgtcgcctgtcgaccccaattccaag
ctcctccacaagccgggcgccgacgacgcgccgccgagctgcgccgccgtgccggccccg
tcccacgccgccgcgccgagccgcaggctgcgcctcgtcagggcggccgcggcggcggcg
cccgcgccggcgatggaccgcgcgccggccgaggccgccgagctgctgcacggcggcgca
gcgggccaggaccacgggcggccccgcggcggggtccctgtgtacgtgatgctgccgctg
gacacggtggggcccggcggccagctgtcgcggcagcgcgcggtggcggcgagtctgatg
gcgctgcggggcgccggggtggagggcgtcatggtggacgtctggtggggcgtcgtggag
cgggagggacccgggcgctacgactgggaggcctacgccgagctcgtgcgcatggtggag
cgcgccggcctgcggctccaggccgtcatgtccttccaccagtgcggcggcaacgtcggc
gacacctgcaacatccccttgccgccatgggtgctggaggagatgagcagcaacccggac
atcgtgtacacggacaggtccggccgccggaaccccgagtacatctccctcggctgcgac
acgctgccggtgctcaagggccggacacccatccaggtctacgccgactacatgcgcagc
ttccacgacaggttccgtgactacctcggcaacgtcattgcggagatccaagtgggcatg
gggccctgtggagagctgaggtatccttcctacccagaggccaacggaacatggcgtttc
ccgggcatcggcgagttccagtgctatgataagtacatgcgggcgtcgctcgaagcagcg
gcggtggcggcggggcacgaggagtggggcaggggcgggccgcacgacgccggcgagtac
aagcagatgcccgaggagacgggcttcttccggcgcgacggcacgtggagcactgagtac
ggccagttcttcctggagtggtactccggcatgctcctggagcacggcgaccgcgtcttg
gccgcagccgatgccgtgttcggcggcacgggcgccacgctctcggccaaggtcgccgga
atccactggcactacgggacccggtcgcacgcggcggagctcacggccgggtactacaac
acgcggcaccacgacgggtacgcgcccatcgcgcgcatgctggccaagcgcggtgccgtg
ctcaacttcacgtgcatggagatgaaggacgagcagcagccgcagcacgccagctgctcg
cccgagcagctcgtgcagcaggtcaaggccgctgccagcgccgccggggtggagctcgcc
ggcgagaacgcgctggagcggtacgacgaagcggcgttctcgcaggtggtgtcaacggcg
cgcggcgcggggctggcggcgttcacgtacctgcggatgaacaaggcgctcttcgacggc
gacaactggcgggagttcgtgtccttcgtccgggccatggccgacggcggcgcgaggccg
gcgctgccgcggtgcgacacggggcactcggacctgtacgtcgggttcctcgacgccgcc
aaggagaggaaagcgccggaggccgagggcgccgccaccgccgtggcattgtag

DBGET integrated database retrieval system