KEGG   Setaria italica (foxtail millet): 101761779Help
Entry
101761779         CDS       T02818                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101761779
Enzymes [BR:sita01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101761779
    2.7.1.82  ethanolamine kinase
     101761779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 369 aa AA seqDB search
MVAIENQSQVARAVAAAEVAPVAGPRIPKEARRLLHELAAAWADVADCRALQVVPLKGAM
TNEVYQVRWLTGVPSAGGEAGEPRGEREVRKVLVRIYGDGVDLFFDREDEVRTFECMSRH
GQGPRLLGRFPNGRVEEFIHARTLSAADLRDPEISALVASKLREFHNLDMPGPKSVLIWD
RLRNWLKTAKNLCSTDEAKEFRLDSLESEITALQNEVSGDYHWIGFCHNDLQYGNIMIDE
ETNMLTIIDYEYASFNPVAYDIANHFCEMAADYHSEKPHILDYNKYPDIDEQKRFVKTYL
SISAGEEPDAEEVESLLQSIEKYTLASHLVWGLWGIISDHVNDIDFDYKEYARQRFEQYW
QKKPANLQS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgatcgagaaccagagccaggtcgcgcgggcggtggcggcggcggaggtggcg
ccggtggcggggccgcggatccccaaggaggcgcggcggctactgcacgagctggcggcg
gcgtgggcggacgtggcggactgccgcgcgctccaggtcgtgccgctcaagggcgccatg
accaacgaggtctaccaggtgcgctggctcaccggggtcccctccgcgggcggcgaggcg
ggggagccccgcggggagagggaggtcaggaaggtgctcgtgcggatatacggcgacggc
gtcgacctcttcttcgaccgcgaggacgaggtgcgcaccttcgagtgcatgtcccgccac
ggccagggcccccgcctcctcggccgcttccccaacggccgcgtcgaggagttcatccac
gcaaggacactgtcagctgctgaccttcgcgatcctgagatttcagctcttgttgcttcc
aaactgagggaattccacaacctcgacatgcctggtcccaaatctgtgctcatttgggac
agactaaggaactggctcaaaactgctaagaacttatgctcaactgatgaagccaaagaa
tttcggttggacagcctggagagtgagattactgcattgcagaacgaagtttcaggtgat
taccactggattggattttgtcacaacgatcttcagtacggcaacatcatgattgatgaa
gagaccaacatgctgaccatcattgattatgagtatgcaagctttaacccagttgcatac
gacattgctaaccatttctgtgagatggcggctgactatcattcagaaaagcctcatatc
ctggactacaacaaatatccagatattgatgagcagaagcgtttcgtcaagacctacctg
agcatttctgcaggtgaggaacctgatgcggaagaggtggagagcctgctccaaagcatt
gagaagtacacgctagccagtcatctagtatggggcctctggggaataatctcagatcat
gtcaacgacattgacttcgactacaaggagtatgcaaggcagagatttgagcagtactgg
cagaagaagcctgcaaatctgcaatcttga

DBGET integrated database retrieval system