KEGG   Setaria italica (foxtail millet): 101761969Help
Entry
101761969         CDS       T02818                                 

Definition
putative MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101761969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 441 aa AA seqDB search
MGSMEPSTAPENGSAAGGGGAACNGAGAAPNGGGMERRLRSSAASASWAAHLPLEVGTRV
MCRWRDQKLHPVKVIERRKGSSSSSPADYEYYVHYTEFNRRLDEWVKLEQLDLDTVETDV
DEKVEDKATSLKMTRHQKRKIDETHVEQGHEELDAASLREHEEFTKVKNIAKIELGRYEI
DTWYFSPFPPEYNDCPKLFFCEFCLNFVKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMF
EVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSE
ESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVL
LEILKKHKGNISIKELSDMTAIKADDILSTLQSLDLIQYRKGQHVICADPKVLDRHLKAA
GRGGLDVDVSKLIWTPYKEQG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggctccatggaaccgtcgaccgcgccggagaacggctccgccgccggcggcggcggc
gcggcgtgcaacggggcgggcgcagcaccgaacggaggaggtatggagaggaggctgagg
tcctcggccgcgtccgcatcgtgggcggcgcacctgcccctggaggtgggcacacgcgtg
atgtgccggtggcgcgaccagaagctccacccggtcaaggtcatcgagcgccgcaagggc
tcctcttcctcttcccccgctgactacgagtactacgtccactacaccgagttcaataga
agactcgatgagtgggttaagcttgagcaacttgatcttgatactgttgagactgatgtt
gatgagaaagtagaagataaggcaacaagcttaaagatgacacggcatcaaaaacgtaaa
attgatgaaacacatgtggagcaaggacatgaggagcttgatgcagccagcttgagggaa
catgaagaattcacaaaggtgaaaaatattgcgaagatagaacttgggagatatgagata
gatacatggtatttctctccttttccaccagagtacaatgactgcccgaagctgtttttc
tgtgaattttgcctcaacttcgtgaagcgcaaagaacagcttcagaggcacatgaagaag
tgcgaccttaaacatcccccaggtgatgaaatctatagaagtggaactctgtcgatgttc
gaggttgatggcaagaagaacaaggtttacggacagaatctttgttatctggccaagcta
tttcttgatcacaagacgttatactatgacgttgatttattcttgttttatgtcctgtgt
gaatgtgatgaccggggatgtcatatggtgggatatttctctaaggaaaagcactccgaa
gaatcttataatttggcttgcattctcactctccctccatatcaaagaaaaggatatgga
aagttcctgattgctttctcatatgagctttccaagaaggaaggtaaagttgggacaccg
gagcgtcctctttctgatcttggtctgctcagttatagaggttattggactagagtgctt
ctagaaattctgaagaaacataagggcaacatatctataaaggaacttagcgatatgacg
gcaataaaagcagatgacatcttgagcacgctgcagagcctggacctaatccagtaccgc
aaagggcagcacgtcatctgcgcggacccaaaggtcctcgaccgccacctcaaggcggcg
ggtcggggcggcctggacgtcgacgttagcaagctgatctggactccctacaaggagcaa
ggctaa

DBGET integrated database retrieval system