KEGG   Setaria italica (foxtail millet): 101762503Help
Entry
101762503         CDS       T02818                                 

Definition
probable histone acetyltransferase HAC-like 3-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101762503
Transcription factors [BR:sita03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101762503
Mitochondrial biogenesis [BR:sita03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101762503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1274 aa AA seqDB search
MMAQTLQGKVMASYAPSSFSIQQQMSPSDFEMLQPDNMDQSTSPIRGIIIQKIASCLKKR
EQFAKTSPDYLLKFSRKIDECLYKRAPKVHYMDLSTLEVRVNALLNSVSHRNHRDSWISS
AAPTTKNLQQLPGIQMIDSSVYHERVDPAFTNLPARARDMPTHTMFTSQRYLPYNHNVAA
ANFHLTERPESFRSTLVAPCVSALPKCSSGLGEIASAGFPNGHVKDNFPGHHILNDMSEF
SPGGAHPVDSPISSMSGSSSPLSAVCDPTTSSNAMIRSSVDSISKASGQKLSAGSDSTGE
GQSFQQYREYEKKLDGAWSQPVEQSVHSNSTTERHEMYQGQCQLDRCVEMKEKFWRMSDC
EDFCRETYSSLSSPSAQYQCCLMADCDPCDPEGERIERSEQTSNSTVSKPSSPVSDESYG
KRPVKRLKADVAGLVDVNQVESPKEQKPVVNGGNHACGETLHSEITELPTKSHCSSLGVI
NADTDDMLRQGSEGVHNMEIVTEKELHCVKDDIEMKDSKSVDQTASGVKLSLRRKGGASI
LYALTAEEIRDHLSSLINQHTCLGKLTSQETQNNEGLPDQNTCSLCGMEKLLFEPPPRFC
ALCFKIINSTGCYYAEVENGKDKSSICSKCHHLSSSRAKYVKRFDYAETDAETEWWVQCD
KCKAWQHQICALFNKKCEGAKAEYTCANCFLKEKDSGDIYALESSTVLGAQELPRTKLSD
HIEQRLSERLEQDRQQRASTSGKGAEEVPRVEGLTVRVVSSADRVLQVQPRFHEFFKQEK
YPGEFPYKSKAILLFQKIEGVDVCLFAMYVQEYGSDCPSPNQRHVYLAYIDSVKYFRPEI
KSASGEALRTFVYHEILIGYLDYCKKRGFVSCSIWACPSTKRDDYVLYCHPTVQKMPKSD
KLRSWYQNLIKKAVKEGVVVERNTLYDFFLQPANECKANISAACLPYCENDFWPGEAERL
LEKKDDKTSQKQETQVGRLLRVAKRDDRKGNLEDILLVHKLGERMRTMKEDFMMLCLQQF
CKHCHQPIVSGRSWVCTSCKNFHLCDKCHAEEQNTAQKDRHPATTKQKHAFERIEVESLP
ETDDGDPIMESKYFDSRIDFLKHCQDNQFQFDTLRRAKHSTMMILYYLHNSSCSACHHAV
DRCLVWRCLRCIGCTFCDPCYKQNGESLHIHELTQIDTSKKNAQDYVECLVHASRCFDPR
NCTLQVCLTLKKLFFHGVRCDIRARNWGGCQKCVFMWKILLHHSKGCNDTDCTVPRCRDI
KVYMAEKMKLPGPV
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgatggctcaaaccctgcaagggaaagttatggcctcctatgcgccgagcagcttctct
attcagcaacagatgtcaccgagcgattttgaaatgcttcagccggataacatggatcag
tctacctctccgatccgcggcattatcattcaaaaaattgcaagttgcctgaaaaagagg
gaacaatttgctaaaaccagcccggattaccttctgaaattttcaagaaaaattgacgaa
tgcctctacaaaagagcaccaaaggtccattacatggatctcagcactctagaagtcagg
gtgaatgctttgctcaattctgtatcgcatagaaaccacagagattcatggatatcctca
gcagctccaacgacaaaaaatttacagcagctgcctgggatacagatgatagactctagt
gtctatcatgagagagttgatcctgcttttactaatttgcctgcacgtgcaagagacatg
cctacacatactatgttcacttctcagagatatttaccatataatcacaatgttgcagct
gctaattttcatctaactgaaaggcctgaaagctttaggagcaccttagttgctccatgt
gtgtcagcacttccaaaatgtagttcaggacttggtgagattgccagtgctggattccca
aatggccatgtaaaggacaattttccaggtcatcacatcctaaatgatatgagcgaattt
tcaccaggtggtgctcatcctgttgatagtccaatatcatctatgtctgggagttccagt
cctttatcagccgtgtgtgatccaaccacaagttccaatgcaatgataagatcatcggtg
gactctatctctaaagcaagtggacaaaaactttctgcaggttctgattccaccggtgaa
ggacaatcatttcaacaatacagagaatatgagaaaaagttagatggtgcatggagccag
ccagtagagcagtcagttcactcaaatagcacaactgaaagacatgaaatgtatcaagga
caatgtcaacttgacagatgcgtggaaatgaaagaaaaattttggcgcatgtcggactgt
gaagatttctgcagggagacatactcaagtttaagctcccccagtgcccagtaccagtgc
tgccttatggcagactgtgatccttgtgaccctgagggagagagaattgagagatctgag
cagacatcaaatagcacagtatcaaagccatcctcacctgtttcagatgaatcttatggt
aagcgtccagtaaagcgcctgaaggctgacgttgccggtcttgtcgatgtcaatcaagta
gagagtccaaaggagcaaaagcctgttgtgaatggggggaatcatgcgtgtggtgaaaca
ttacactcagaaatcacagaattgcctacaaaatcacattgcagttccttgggtgtcatt
aatgctgacaccgatgatatgctacgacagggtagtgaaggtgtacataacatggagatt
gttacagaaaaagaattgcactgtgtaaaggatgacattgagatgaaagactctaagagt
gtggatcagacagcaagtggggtcaaattaagtttgaggaggaaaggaggagcttctata
ctttacgcattaactgccgaggagattcgagatcacctgagtagtctaataaaccagcat
acttgtttgggcaagttgacatctcaagaaacccaaaataatgaaggcttgcctgatcag
aatacatgcagtttatgtgggatggagaagcttctttttgaaccacctccacgattttgc
gctctctgtttcaaaataataaattctactggttgctattatgctgaagttgaaaatgga
aaggataaatcttcaatttgtagcaaatgccaccatctaagcagttccagagctaaatat
gttaagagatttgattatgctgaaacagatgctgaaactgaatggtgggtccagtgcgac
aagtgcaaagcttggcaacatcaaatctgtgctctgttcaacaaaaaatgtgaaggggca
aaggctgaatatacttgtgcaaattgttttttgaaggaaaaggatagtggagacatttat
gcactggagtcatccactgttcttggagcacaggagttgccaagaactaaattaagtgat
catatcgagcaaaggctttctgagaggctggagcaggacaggcaacagagggcaagcacc
tcaggaaagggcgctgaagaggtaccacgagttgaaggtcttacagttagagtagtatct
tcagctgacagagtactgcaagtccaaccacgttttcatgaattttttaaacaagaaaag
tatcctggggaatttccatacaaatcgaaggcaattctcttgtttcaaaagattgaaggt
gtggatgtttgcctgtttgccatgtatgtacaagagtacggttcagattgtccatcacca
aatcagaggcatgtttatcttgcatatatcgattctgtcaagtacttcaggcctgaaata
aaatctgcaagtggggaggctctccgtacctttgtgtatcatgaaattttgattggttat
ctggattactgcaagaaacgaggatttgtaagttgttccatatgggcttgcccatctacg
aagcgtgatgattatgttttatattgtcatccaacagtacaaaagatgcccaagtcggac
aaacttcgaagctggtatcagaacttgatcaagaaggctgttaaggagggtgtagttgtg
gagcgtaatacactctatgactttttccttcagcctgccaatgaatgcaaggccaatata
tcagcagcatgcttgccatactgcgagaacgatttctggcctggagaagcggagaggctc
cttgagaagaaagatgataaaacctcacagaagcaagagacacaagtaggaaggctctta
cgtgttgccaaacgtgatgacagaaaaggaaaccttgaggatattttacttgtgcacaag
cttggagaaaggatgcgcaccatgaaagaagacttcatgatgctttgtctgcagcagttt
tgcaagcactgtcaccaacctattgtatctggcagaagttgggtttgcactagctgtaaa
aattttcatctttgtgacaagtgtcatgcagaggagcagaatacagcacagaaggacagg
catccagccacaacaaaacagaagcatgcatttgaaagaatagaggtagaatctcttcca
gagactgacgatggagatccaataatggaaagcaagtattttgacagcagaatagatttc
ttgaagcactgtcaagacaatcaattccagtttgataccctccggcgggcaaagcattct
acaatgatgattctttattatctacataattcaagttgttctgcttgccaccatgctgtg
gatcggtgcttggtgtggcggtgcctacggtgcataggctgcaccttttgtgatccatgc
tacaaacaaaatggtgaaagtttgcatattcatgaattaacacagattgacactagcaag
aagaatgcacaggactatgttgaatgccttgtgcatgcatcgagatgcttcgatcctcgc
aactgcactcttcaagtttgtttaacgttgaagaagctgttcttccatggcgtacggtgt
gatatccgtgcccgtaattggggaggttgccagaagtgtgtcttcatgtggaaaattctg
ctccaccactcaaaaggttgcaatgatacagactgtacggttccgagatgcagggatata
aaggtatacatggctgaaaagatgaagcttcctggtcctgtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system