KEGG   Setaria italica (foxtail millet): 101763110Help
Entry
101763110         CDS       T02818                                 

Definition
(RefSeq) (R)-mandelonitrile lyase-like
  KO
K08248  
(R)-mandelonitrile lyase [EC:4.1.2.10]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Cyanoamino acid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101763110
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     101763110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
IV
AA seq 585 aa AA seqDB search
MSMAAISTRLYLLFGILLVPSLAAAQSRAFGGVPPAYARYLVDAAAMPAVELYDYIVVGG
GTAGCPLAATLAGPGGGRVLLLERGGAPSEFPALATAGGFVRTLAMADPAPESDAPAQGF
TSEDGVPNVRARVLGGGTAINAGFYSRAHPEWFRGRAEDGEVTNWDMRLVNASYEWVERQ
MTFQPTVRGFQAAMRAALLEANVTPWNGFTVDHVTGTKVGATTFDASGRRHSAADLLAFA
RPSRLRVAIRATVTRIITNPIDPSARHGRSPQPTIAAVGVVYQDRLLDQHQALLRPGGEV
ILSAGAMGSPQLLLLSGIGPASDLSYLGIPVSADIPDVGKHMFDNPRNGISIIPSVPVDH
SLIQVVGIPSANGAASYLEAASYIVPLAPALRSSGPFIGSSSPLFVTVATIMEKVPGPLS
EGSLWLSSSNPLESPPLRFNYLSRPEDLARCVLGVRRVAEVLEGRALDGFRSAVGSTNRR
GAVRRDFRIVGAALPVDWRTNDRALADYCQQTVATLWHYHGGCVAGKVVDRDFRVIGARA
LRVVDASTFSETPGTNPQATVLMMGRYMGLKMIEERHSRRPVIPS
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtccatggccgcaatctccacgcggctctacctcctcttcggcatcctcctcgtgccg
tccctcgccgccgcccagtcccgcgctttcggaggggtgccgccggcgtacgcgcggtac
ctggtcgacgcggcggcgatgccggcggtggagctgtacgactacatcgtggtgggcggc
ggcacggcggggtgcccgctcgcggcgacgctggcggggcccggcggcggacgcgtgctc
ctgctcgagcgcggcggcgcgcccagcgagttccccgcgctcgccacggccggcgggttc
gtcaggacgctcgccatggcggacccggccccggagtccgacgcgcccgcgcaggggttc
acgtccgaggatggcgtccccaacgtgcgcgcgcgcgtgctcggcggcggcacggccatc
aacgccggcttctactcgcgcgcgcaccccgaatggttccgcggccgcgccgaggatggc
gaggtgacgaactgggacatgcggctggtgaacgcgtcgtacgagtgggtggagaggcag
atgacgttccagccgacggtgcgtgggttccaggcggcgatgagggcggcgctgctggag
gctaatgtcacgccatggaacggcttcacggtggaccacgtcaccggcaccaaggtcggt
gccaccactttcgatgcatcgggccggcggcacagcgccgcggacctcctcgcgttcgcc
cggcctagccgtctccgtgttgccatccgagctacagttacccgtatcatcaccaaccca
attgacccatctgcacgccatggaaggtctccacaaccaacaatagcagcagttggtgtt
gtgtaccaggaccgtctcctcgatcagcaccaagccctcctgcgtccaggtggggaggtt
atactttcagcaggtgccatggggagtccgcagttgcttcttctcagcggcattggccct
gccagtgatctttcctaccttggcatccctgtttctgctgatatccctgatgttggcaag
cacatgttcgacaaccctcgcaatggcatctccatcatcccatcagtcccggttgatcac
tcccttatccaggttgtcggcatcccgtcagctaatggagctgcctcctaccttgaggca
gcatcatacattgtcccacttgctccggcgttgagatcttccggtcctttcattggctcg
tcttcaccactctttgttactgtggcaactatcatggaaaaggttcctggcccattatct
gaaggttcactctggctttcatcgtcaaatccattggagagtccccctctacgattcaac
tacctgagtcgccctgaggacttggcgcgatgcgtcctgggtgttcgtcgagtggcagaa
gtgcttgaaggtagagcattggacggatttcgctcagcggttggatcgacgaataggaga
ggggcagttaggagggacttcaggattgttggagcggcactaccagtagattggagaaca
aacgatagagctcttgcagattactgccagcagactgtggcaacgctatggcattaccat
ggagggtgtgtcgccgggaaggtggttgatagagatttccgggtaattggtgcccgtgca
cttcgtgtggttgatgcatcaacattcagtgagacacccgggacaaatcctcaagctaca
gtcttgatgatgggcaggtatatggggttgaagatgattgaggagagacacagcagaagg
ccagttataccatcatag

DBGET integrated database retrieval system