KEGG   Setaria italica (foxtail millet): 101763600Help
Entry
101763600         CDS       T02818                                 

Definition
4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sita00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 580 aa AA seqDB search
MVLARVLTLPLPAPSSTPHRRFLLPPRAARVLPVRAAACRAASAMAAVAALDPAAAAAVG
VGEELPEGYDQMMPTVEPARRRRAGVLLHPTSLRGPHGIGDLGDEALAFLHWLRDAGCTL
WQVLPLVPPGRSAGEDGSPYSGQDANCGNTLLISLEELVKDGLLMEDELPSPVDVEYVEF
DTVANLKEPLIAKAAERLLLGQGELRTQYDCFKKDPNISAWLEDAALFAAIDRSIGAFSW
YEWPEPVKNRHLGALEDIYLKQKDFIETFMAQQFLFQRQWQRIRKYAQKLGISIMGDMPI
YVGYHSADVWANRKSFLLDKNGFPTFVSGVPPDAFSETGQLWNSPLYDWRAMEADGFSWW
IKRIKRALDLYDEFRIDHFRGLAGFWAVPSDAKVALVGSWRAGPRNAFFDAIFKAVGSIN
IIAEDLGVITEDVVQLRKTIGAPGMAVLQFAFGSGSDNPHLPHNHEMDQVVYTGTHDNDT
VLGWWKTLPEEERQIVIKYLPEAENTDISWTLITAALSSVARTSMVTMQDILGLDSSGRM
NTPATQKGNWRWRIPSSVGFDSLSPEAAKLKELLALYNRL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggttctcgcgcgcgtcctcacgctcccgctgcccgccccgtcttccacgccccaccgc
cgcttcctcctcccgccccgggcggcgcgcgtgctccccgtgcgggccgcggcctgccgc
gcagcgagcgcgatggcggccgtggcggcgctggaccccgccgcggccgcggccgtgggc
gtcggggaggagctgccggaggggtacgatcagatgatgcccaccgtggagccggcgcgg
cggcggcgtgcgggggtgttgctgcacccgacgtcgctccggggcccgcacggcattggc
gacctcggcgacgaggcgctcgccttcctccactggctacgcgacgccggctgcacgctc
tggcaggttctgccacttgttcctccagggaggtcggctggggaggatggatctccttat
tctgggcaggatgccaactgtggtaatacccttttgatatctcttgaagagcttgtaaaa
gatggtctattgatggaagatgaacttcctagtcctgtggatgtggagtatgttgaattt
gacaccgttgcaaatctgaaagaacctcttattgcaaaggcagcagagaggctcttactg
ggtcaaggagagctcagaacacaatatgactgcttcaagaaagatccaaatatatcagct
tggcttgaagatgcagcactttttgctgctattgacagaagcattggtgcattctcctgg
tatgagtggcctgaacctgtgaaaaatcgccatcttggagccttggaagacatatatcta
aaacagaaggactttatagagacatttatggctcagcaattcttatttcaaaggcaatgg
caacggatccgtaaatatgcacagaagctgggtatcagcataatgggtgacatgcctata
tatgttggctaccatagtgcagatgtatgggcaaacaggaaatcatttttgctggacaag
aatggcttccccacttttgttagtggtgtcccacctgatgcatttagtgaaactggtcag
ctatggaacagtccattgtatgactggagagctatggaagcagatggcttttcatggtgg
ataaagaggattaaacgagcccttgatttgtatgatgagttccgtatcgaccatttccgg
gggcttgcaggtttttgggcagtaccttctgacgcaaaagtagcactagttggaagctgg
agggctggaccaaggaatgccttttttgatgcgatcttcaaggctgttggtagcataaat
ataatagcagaagacctgggggtgattactgaagatgtcgttcagctaaggaaaacaatt
ggggcccctgggatggcagttctccagtttgcctttggatctggctctgacaaccctcac
ttgccgcataaccatgaaatggaccaagttgtgtacaccggaacacatgataatgataca
gttcttggctggtggaaaactttacccgaggaagagaggcaaattgtgattaagtatcta
ccggaagccgagaatactgacatctcatggacactgattactgctgctctttcttctgtt
gcgaggacttccatggtaaccatgcaggatattcttggcctcgacagttctggtagaatg
aacactccagctacccagaaaggaaactggagatggaggataccgagctccgttggcttc
gacagccttagccctgaggcagcaaagctgaaggagttgcttgcgctgtacaatcgtctg
tga

DBGET integrated database retrieval system