KEGG   Setaria italica (foxtail millet): 101765186Help
Entry
101765186         CDS       T02818                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5-like
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
sita  Setaria italica (foxtail millet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 328 aa AA seqDB search
MSWCTIESDPGVFTELIQQMQVKGVQVEELYSLDVDSLSELRPIYGLIFLFKWIPGEKDE
RPVVRDPNPNLFFAHQVINNACATQAILSVLMNRPEIDIGPELSQLKEFTGAFTPDLKGL
AIGNSESIRTAHNSFARPEPFISDEQRAATKDDDVYHFISYLPFEGVLYELDGLKEGPVN
LGQCGGLDDLDWLQMVQPVIQERIERYSQSEIRFNLMAIIKNRKEVYSAELEDLEKRREQ
ILQEMNKTSATESLNNSLTEVISAIETVSEKIIMEEEKFKKWKTENIRRKHNYIPFLFNL
LKMLAEKQQLKPLVEKAKQQKSSSPSTR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggtgcacgattgagtctgaccctggtgttttcaccgagttgatccagcaaatg
caagtgaaaggtgtgcaggtggaagagctttactctcttgatgtggactctcttagtgaa
ctgcggccaatatatgggctaatttttctcttcaagtggatacctggggaaaaggatgaa
cgacctgttgtcagagatcctaatccaaaccttttctttgctcaccaagtgatcaataat
gcatgtgctactcaagctattctctcagttctcatgaaccgcccagaaattgacataggt
ccagagttatctcaattgaaggaattcacaggagcttttacacctgatctgaagggctta
gccatcggcaacagcgaatccattcggacagctcataacagttttgcaaggccagagcca
ttcatttctgatgagcagagagccgcgactaaggatgatgatgtgtaccatttcataagc
tatttaccttttgaaggtgtgctctatgagctggatgggctgaaggaagggcctgtaaac
cttgggcagtgcggtggtcttgatgacctcgattggctacagatggtgcagccagtcatt
caagaaagaatcgagcgttattcacagagtgagattaggttcaatcttatggccatcata
aagaataggaaggaggtgtacagtgccgagctggaggatctggagaagagaagggagcaa
attttacaggagatgaacaagacttccgccacagaatctttgaacaactcgctcacagag
gtgatatcagcaattgaaactgtcagcgagaagatcatcatggaagaagagaagttcaag
aagtggaagacggagaacatccggaggaagcacaactacatccctttcctgttcaacttg
ttgaagatgcttgcagagaagcagcagctgaaacctctggtggagaaggccaagcagcaa
aagtcgtcgagcccaagcacaagatga

DBGET integrated database retrieval system