KEGG   Setaria italica (foxtail millet): 101767262Help
Entry
101767262         CDS       T02818                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 2
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00052  Galactose metabolism
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101767262
   00500 Starch and sucrose metabolism
    101767262
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101767262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C T3SS_needle_reg
Motif
Other DBs
NCBI-GeneID: 101767262
NCBI-ProteinID: XP_004975572
UniProt: K3Y652
Position
VII
AA seq 580 aa AA seqDB search
MGALVIRVACAWLLLLQLTGASHVVYNYKELETEAATANVPPSIVDPLLRTGYHFQPPKN
WINDPNAPMYYNGWYHFFYQYNPKGAVWENIVWAHSVSRDLINWEALETAIEPSIPGDKY
GCWSGSATTLPCGTPVIMYTGINRPDVSYQVQNIAFPKNKSDPMLREWVKPGHNPIIVPE
ADINATQFRDPTTAWLSGGQWRLLIGSAAEGGSRGVAYVYRSRDFRRWRRVERPLHSAAT
GMWECPDFYPVEAGYADGLEASASGPKVKYVLKNSLDLRRYDYYTVGTYDEKAERYVPDD
AAGDEHHLRYDYGNFYASKTFYDPAKKRRVLWGWANESDTRTHDVAKGWAGIQAIPRKVW
LDFSGKQVLQWPIEEVEALRHQPVTLKDKVIKPGKHVEVTGLQTAQADVEVSFALSSLEG
AETLDPALAHDAERLCGVKGADVQGGIGPFGLWVLASADMQERTAVFFRVFKAAGKDKPV
VLMCTDPTKSSLNPDLYLPTFAGFVDTELPDGKISLRTLIDRSVVESFGAGGKTCILSRV
YPSLAIDKNAHLYVFNNGKADVKVSLLTAWQMKKPLMNGA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgggagctcttgtgataagggttgcttgcgcgtggttgcttttgttgcagctcaccgga
gcgtcccatgtcgtctacaactacaaggagcttgagacggaggcggccacggcgaacgtg
ccgccgtccatcgtcgaccccctcctgagaaccgggtaccacttccagccccccaagaac
tggatcaatgatcccaacgcgcccatgtactacaacggctggtaccatttcttctaccag
tacaaccccaagggcgccgtgtgggagaacatcgtgtgggcgcactcggtgtcgcgagat
ctcatcaactgggaggccctagagacggcgatcgagcccagcatcccgggcgacaagtac
ggctgctggtcaggctcggctaccacgctgccctgcggcacgccggtgatcatgtacacg
ggcatcaaccgcccggacgtcagctaccaggtccagaacatcgccttcccgaagaacaag
tcagacccgatgctccgggagtgggtgaagcccgggcacaaccccatcatcgtgcccgag
gccgacatcaacgcgacgcagttccgggacccgaccaccgcgtggctctccggcggccag
tggcggctgctcatcggcagcgcggccgagggcggctcccggggcgtggcgtacgtgtac
cggagccgcgacttcaggcggtggaggcgggtggagcggccattgcactcggcggcgacg
gggatgtgggagtgcccggacttctacccggtcgaggcgggctacgccgacgggctcgag
gcctccgcgtccgggccgaaggtgaagtacgtgctgaagaacagcctcgacctgcggcgc
tacgactactacaccgtcggcacgtacgacgagaaggccgagcggtacgtgccggacgac
gccgccggcgacgagcaccacctgcgatacgactacggcaacttctacgcgtccaagacg
ttctacgacccggcgaagaagcgccgggtgctctggggatgggccaacgagtccgacacc
cgcacccacgatgtcgccaaggggtgggctggaatccaggcgattccaaggaaggtttgg
ctcgacttcagcgggaagcaggtgttgcagtggccgatcgaggaggtcgaggccctccgg
caccagccagtcactctcaaggacaaggtgatcaagccagggaaacacgtcgaggtgacg
gggctacagacagcacaggctgacgtggaggtgagcttcgcgttgtcgagcctggagggg
gccgagacgctggacccggcgctcgcccacgacgccgagaggctgtgcggcgtcaagggc
gccgacgtgcagggcggcatcgggccgttcgggctgtgggtgctcgcgtccgccgacatg
caggagaggaccgcggtgttcttcagggtgttcaaggccgccggcaaagacaagcccgtc
gtgctcatgtgcaccgacccaaccaagtcgtctctcaatccagacctgtacctgccgaca
tttgcaggttttgtagatacagaacttccagacggcaagatatctctgagaaccttgatc
gaccgatccgttgttgagagctttggagccgggggcaagacgtgcatcctctcgagggtc
tacccgtcgctcgccatcgacaagaacgcccacctctacgtgttcaacaacggcaaggcg
gacgtcaaggtgtcgcttctgacggcgtggcagatgaagaagccactcatgaacggcgcc
tga

DBGET integrated database retrieval system