KEGG   Setaria italica (foxtail millet): 101767487Help
Entry
101767487         CDS       T02818                                 

Definition
7-dehydrocholesterol reductase-like
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101767487
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101767487
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 456 aa AA seqDB search
MAKAKPSSSASAAKQAAAAAAPVPPATVHSALVTYSSMLALLSLCPPFVILLWYTMVHAD
GSVVKTYEHLREHGVVEGLKAIWPMPTVVAWKIIFGFGLFEAVLQLLLPGKRFEGPISPA
GNVPIYKANGLQAYAVTLITYLGLWWFGIFNPAIVYDHLGEIYSALVFGSFVFCIFLYIK
GHVAPSSSDSGSSGNVIIDFYWGMELYPRIGKYFDIKVFTNCRFGMMSWAVLAVTYCIKQ
YEMNGRVADSMLVNTALMLIYITKFFWWESGYWCTMDIAHDRAGFYICWGCLVWVPSIYT
SPGMYLVNHPVNLGPQLALSILLAGILCIYINYDCDRQRQEFRRTNGKCSVWGKAPSKIV
ASYQTTKGENKTSLLLTSGWWGLSRHFHYVPEILSAFFWTVPALFSHFLPYFYVIFLTIL
LFDRAKRDDDRCSSKYGKYWKMYCNKVPYRVIPGMY
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccaagccctcctcctcggcctccgccgccaagcaggccgcggccgcggcg
gcgcccgtgccgccggccacggtgcactcggcgctggtcacctactcctccatgctcgcg
ctcctctcgctctgcccgcccttcgtcatcctcctgtggtacacgatggtgcacgcggac
ggatcggtggtgaagacctacgagcacctccgggagcacggcgtggtggaggggctcaag
gccatctggcccatgcccaccgtcgtcgcgtggaagatcatcttcggcttcgggctcttc
gaggccgtgctgcagctgctgctccccgggaagcggttcgagggtcccatctcccccgcg
gggaacgtgcccatctacaaggcaaatggcttacaagcatatgcagtgactttgataact
taccttggcttgtggtggttcggaatatttaaccctgcaatagtatacgaccacttgggg
gagatatactctgctcttgtttttggaagctttgtattctgtatttttctgtacataaag
ggtcacgtagctccatcttcttctgactctggatcctcagggaatgtgataatcgacttc
tattggggtatggaactgtaccctcggattggcaagtactttgatatcaaagtcttcaca
aactgtcgttttggcatgatgtcctgggctgttcttgctgtaacctactgcataaagcag
tatgaaatgaatggcagagtcgcagattctatgcttgtgaatactgcactgatgttgatc
tatatcactaagttcttttggtgggaatctggatattggtgtaccatggacattgctcat
gatagagctggtttctacatttgctggggatgcttggtatgggttccatccatatatacc
tctcctggaatgtaccttgtaaaccaccctgtgaatttgggtccccagctagcactctca
attcttcttgctggaattttgtgcatatacataaactatgattgtgaccgccagcgccaa
gaatttcgacggacgaatgggaaatgctcagtctggggcaaggctccatccaagattgtc
gcctcatatcagactactaagggagaaaataaaaccagtcttctcttgacttctggatgg
tggggcttgtcacggcacttccactacgtcccagagatactttctgcatttttctggact
gttcctgctcttttcagtcatttcctgccatacttctacgtgatctttttaacaatatta
ttgtttgaccgagcgaagagggatgatgatcggtgctcatcaaagtacggaaagtattgg
aagatgtactgcaacaaagtaccatacagggtcatccctggcatgtactga

DBGET integrated database retrieval system