KEGG   Setaria italica (foxtail millet): 101767766Help
Entry
101767766         CDS       T02818                                 

Definition
NADPH--cytochrome P450 reductase-like
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
sita  Setaria italica (foxtail millet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 702 aa AA seqDB search
MDSATSGAMELVAALLRGRVPPELMGGEGAEGRALVATLAAAVLGAALFVLWRRAAAGKK
RKREVAVAEAAQVKARGAKGAADEAFADDGRKKVTVFFGTQTGTAEGFAKSLAEEAKARY
DKAIFKVADLEDYAAEDEEYEEKLKKEKLALFFVATYGDGEPTDNAARFYKWFTEGNERG
VWLSDLEYAVFGLGNRQYEHFNKVAKVVDELLTEQGGKRLVPVGLGDDDQCIEDDFNAWK
EALWPELDRLLRDENDVSTGTTYTAAISEYRVEFMKPEEAAHLEKNFSLANGHAVHDAQH
PCRANVAVRRELHSPASDRSCTHLEFDIAGSGLMYETGDHVGVYTENCPDVVEEAERLLG
YSPETFFTIHADNEDGTPLGGGSLAPPFPSPITVRNALARYADLLNSPKKSSLLALAAHA
SDLAEADRLRFLASPAGKDEYAQWVVANQRSLLEVMAEFPSAKPPLGVFFAAVAPRLQPR
YYSISSSPSMAPTRIHVTCALVNETTPAGRVHKGVCSTWIKNAVPSEESKDCSWAPIFVR
QSNFKLPADPSVPIIMIGPGTGLAPFRGFLQERLAQKESGVELGRSVFFFGCRNSKMDFI
YEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVCGDAKG
MAKDVHKVLHTIVQEQGSLDSSKAESFVKNLHTEGRYLRDVW
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggactcggcgacgtcgggggcgatggagctggtggcggcgctgctgcggggtcgcgtc
ccgccggagctgatgggcggggagggcgccgagggccgcgcgctcgtggccacgctcgcg
gccgccgtgctcggcgccgcgctcttcgtgctctggaggcgggccgccgccgggaagaag
cggaagcgggaggtggccgtcgcggaggccgcgcaggtcaaggccaggggcgccaagggc
gccgcggacgaggccttcgccgacgacggcaggaagaaggtcaccgtcttcttcggcacg
cagaccggcaccgccgaggggttcgccaagtcgcttgctgaggaggcaaaggcaagatac
gacaaggcaatctttaaagttgcggacttggaagattatgccgcagaggatgaggaatac
gaggagaagttgaagaaggagaagctagcgttgttcttcgtggcaacgtacggagatggt
gagccaacagacaatgccgctaggttctacaaatggttcactgaggggaatgagagggga
gtatggttgagtgaccttgagtatgctgtgtttggtctgggcaatcgacagtacgagcat
ttcaacaaggttgccaaggtggtcgacgagctcctaactgaacagggtggaaaacgcctt
gtgccggttggtcttggagacgatgatcaatgcattgaggatgacttcaatgcatggaaa
gaagctctctggccagagttggatcgtttacttcgtgatgaaaatgatgtctccacaggc
actacttacacagctgctatttctgaataccgggttgaatttatgaagcctgaggaggca
gctcatttggagaaaaacttcagccttgcaaatggtcatgcagtccatgatgctcagcac
ccttgccgggctaatgtggctgtgcggcgggagctccacagtcctgcttctgatcgttca
tgcactcacttggaatttgacattgctggatctggtcttatgtatgaaactggtgaccat
gttggtgtatacaccgagaactgccctgacgttgtagaggaggcagagaggttgttaggc
tactcaccggagacattttttaccatccatgcagacaatgaggatggtactccactaggt
ggtggatctcttgctcctcctttcccctccccaatcaccgtgaggaatgcacttgcccga
tatgccgatcttctgaattcaccaaagaagagttcgctgcttgcattagctgcacatgct
tcagatcttgctgaggctgatcgtttgaggttcttggcctctcctgctgggaaggatgag
tacgctcaatgggttgtggcaaatcagaggagcctgttggaagtcatggcagagttccct
tcggcaaagcctcccctaggagtcttctttgcagctgtggcccctcgtcttcaaccgaga
tattactctatttcatcttcaccaagtatggcaccaactaggattcatgtcacatgtgcg
cttgtgaatgaaacaacacctgctggaagggtacataagggggtctgctcaacttggatc
aagaatgctgttccatcagaagagagcaaggactgcagctgggctccgatatttgtgagg
caatcaaacttcaaactgccagctgatccttcagtgccaattatcatgattggccctggg
accggtctagcacccttccgtggcttcttgcaggagaggctagctcaaaaagaatctgga
gtggagcttggtcgatccgtgttcttctttggatgcagaaacagcaagatggacttcatc
tatgaggatgagttgaacaatttccttgagcaaggagcactgtctgagctggttcttgca
ttctcgcgccagggccctaccaaggaatatgtgcaacacaaaatggcgcagaaagcatct
gaaatctgggacatgatctcccaaggtgcttacatctacgtctgcggtgatgccaaaggc
atggccaaagatgtacacaaagttctccacaccatcgttcaggagcagggttcacttgac
agttccaaagcagagagctttgtgaagaatctccatacggagggcagatatctgagggat
gtgtggtaa

DBGET integrated database retrieval system