KEGG   Setaria italica (foxtail millet): 101767913Help
Entry
101767913         CDS       T02818                                 

Definition
glutamate--glyoxylate aminotransferase 1-like
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Photorespiration
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101767913
   01210 2-Oxocarboxylic acid metabolism
    101767913
   01230 Biosynthesis of amino acids
    101767913
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101767913
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101767913
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101767913
   00260 Glycine, serine and threonine metabolism
    101767913
Enzymes [BR:sita01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101767913
    2.6.1.4  glycine transaminase
     101767913
    2.6.1.44  alanine---glyoxylate transaminase
     101767913
    2.6.1.-  
     101767913
Amino acid related enzymes [BR:sita01007]
 Aminotransferase (transaminase)
  Class I
   101767913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 539 aa AA seqDB search
MARKPLDYEELNENVKKVQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLMFPADAIARAKHYLSLATGGLGAYSDSRGIPGIRKEVADFI
QRRDGYPSDPELIYLTDGASKGVMQMLNTIIRNERDGILVPVPQYPLYSATISLFGGSLV
PYYLEEEANWGLDFVNIRKTVAEARSKGITVRAMVIINPGNPTGQCLSEANIKEVLQFCY
HENLVLLADEVYQQNVYQDERPFISAKKVLFDMGPPLSREVQLVSFHTVSKGYWGECGQR
GGYFEMTNLPPQTVDEIYKVASIALSPNVPGQIFMGVMVNPPKPGDISYLKFAAESKSIL
DSLRRRARMMTDGFNSCRNVVCNFTEGNIRIVNFSGLQQLDYNYSLITDFFFAILLLQEL
CTHSPKYACHQEQSRQRKELAKHQMFSTASSFWKQLGFPLFRDLVLVRRKGCSTSGRRSF
LQRKTSLPSCRASRISMTHSWRNTRATPGCEEEHHSKGRIGCQILCFSLSAIKHLQGHY
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagccgctggattacgaggagctgaacgagaacgtcaagaaggtgcagtac
gcggtgcgcggggaactctacctccgcgcctccgagctccagaaggagggcaagaagatc
atcttcaccaacgtcggcaacccgcacgccctcggccagaagccgctcaccttcccgcgc
caggtggtggccctctgccaggctccgttcctgctcgatgatcccaacgtcggcctcatg
ttcccggcggatgccatcgcgcgcgccaagcactacctctccctggcgaccggcggttta
ggcgcttacagtgattcccgtggtatccctggaattaggaaggaggttgctgacttcatc
cagaggcgtgatggatatccaagtgatccagagctcatttacttgacagatggtgccagc
aaaggtgtcatgcagatgctgaacaccattatcagaaacgagagagatgggattttggtc
cctgttcctcaatacccactttattctgctaccatttccctctttggtggctctctggtt
ccgtactacttggaagaagaggctaactggggccttgactttgtcaatatccgaaaaaca
gtggcagaggcaagatcaaagggaatcactgttcgagcaatggtgattataaatccggga
aatcccactggccaatgccttagtgaagcaaatataaaggaagttctgcaattttgctac
catgaaaacttagttctgcttgcagatgaagtgtatcagcagaatgtttatcaagatgag
cgcccgtttataagcgcaaaaaaggttttgtttgacatgggtccaccgctaagcagggag
gttcagcttgtttctttccacactgtgtccaaagggtactggggagagtgtgggcaacgt
ggtggatactttgaaatgacaaatcttcctccacagacagtagatgagatctacaaggtt
gcatcaatagcactgagcccgaatgtccctgggcaaatttttatgggagtgatggttaac
cctcctaaacctggagatatctcatacctgaagtttgctgctgaaagcaagtccatcctc
gattctttgaggaggagagcacgcatgatgacagatggtttcaacagttgccgaaatgtc
gtgtgtaatttcacagaaggtaacatcagaattgtaaactttagtggtttgcagcaatta
gactacaattatagcttaattactgattttttttttgcaattttgttgttgcaggagcta
tgtactcattcccccaaatacgcctgccaccaagagcaatcgaggcagcgaaaagagctg
gcaaagcaccagatgttttctactgcctcaagcttctggaagcaactgggatttccactg
ttccgggatctggttttggtcagaaggaaggggtgttccacctccggacgacgatccttc
ctgcagaggaagacttccctgccatcatgtcgagcttcaagaatttcaatgactcattca
tggcgcaatacgagggctactccaggatgtgaagaggaacatcacagcaaaggaaggatc
ggctgtcagattctctgtttcagtctcagcgcgatcaagcatttacaaggacattattaa

DBGET integrated database retrieval system