KEGG   Setaria italica (foxtail millet): 101769770Help
Entry
101769770         CDS       T02818                                 

Definition
dihydroflavonol-4-reductase-like
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101769770
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     101769770
    1.1.1.234  flavanone 4-reductase
     101769770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 372 aa AA seqDB search
MGEVAVKGEAMKQGGATAKGPVVVTGASGFLGSWLVMKLLQAGYTVRATVRDPTNVAKTK
PLLELPGAAERLSIWKADLTEEGSFDEAIKGCTGVFHVATPMDFESKDPENEVIKPTVEG
MLSIMRACKEAGTVRRVVFTSSAGTVNIEERQRPVYDQNNWSDVDFCRRVKMTGWMYFVA
KSLAEKAAMAYAAEHGLDLISIIPTLVVGPFLSVAMPPSLVTALALVTGNEAHYSILKQV
QFVHLDDLCDAEIFLFENPDAAGRYVCSSHDSTIHGLAAMLRERYPEYRIPERFREIDDG
DLQPVHFSSKKLLDHGFTFRYTVEDMFDAAIRTCREKGLIPLATAGGDGSASAREPGEAD
AALGRDGPAVGA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgggggaggtggccgtgaagggagaggcgatgaagcagggaggcgcgaccgccaaaggg
ccggtggtggtgacgggggcgtcgggcttcctcggctcctggctcgtcatgaagctcctc
caggccggctacaccgtccgggccaccgtgcgcgaccccaccaacgtcgccaagacgaag
ccgttgctggagcttcccggagcagcggagcggctgtccatctggaaagccgacctgacc
gaggaaggcagcttcgacgaggccatcaagggatgcaccggcgtcttccacgtcgccacg
cccatggacttcgagtccaaagacccagagaacgaggtgatcaagccgacggtggaaggg
atgctgagcatcatgcgagcctgcaaggaggccggcaccgtgcgccgcgtcgtcttcacc
tcctccgccgggacggtcaacatcgaggagcgccagaggcccgtctacgaccagaacaac
tggagcgacgtcgacttctgccgccgcgtcaagatgaccggatggatgtacttcgtggcc
aagtccctggcggagaaggcggccatggcgtacgcggcggagcacgggctggacctgatc
agcatcatcccgacgctggtggtcggcccgttcctgagcgtggccatgccgcccagcctc
gtcaccgcgctggcgctcgtcacggggaacgaggcccactactccatcctcaagcaggtg
cagttcgtccacctcgacgacctctgcgacgccgagatcttcctcttcgagaaccccgac
gccgccggccgctacgtctgctcctcccacgactccaccatccacggcctcgccgccatg
ctcagggagaggtaccccgagtaccgcatcccggagaggttccgggagatcgacgacggc
gacctccagcccgtgcacttctcgtccaagaagctcctcgaccacgggttcacgttcagg
tacacggtggaggacatgttcgacgccgccatccggacgtgccgggagaagggcctgatc
ccgctcgccacggccggaggggatggctctgcctcagcgcgcgagcccggcgaagcggat
gcagctcttgggagggatgggccggctgttggcgcttag

DBGET integrated database retrieval system