KEGG   Setaria italica (foxtail millet): 101769819Help
Entry
101769819         CDS       T02818                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101769819
Transfer RNA biogenesis [BR:sita03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101769819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 572 aa AA seqDB search
MATAAAAAAVAAPEQPRRRKPAPGRGGVVLPAGLSEEEARVRAIAEIVSAMGELSRRGED
VDLNELKSAACRKYGLARAPKLVEMIAAVPEADRAALLPRLRAKPVRTASGIAVVAVMSK
PHRCPHIATTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARSRIDQL
KRLGHSVDKVEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVCYSEHSAVKC
IGMTIETRPDYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAK
DAGFKVVAHMMPDLPNVGVERDLESFREFFESPAFRADGLKIYPTLVIRGTGLYELWKTG
RYRNYPPELLVDIVARILSMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLG
LKCRDVRTREAGIQDIHHKIRPDEVELVRRDYAANEGWETFLSYEDTRQDILIGLLRLRK
CGRNVTCPELVGRCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARREHRS
KKLAVISGVGTRHYYRKLGYELEGPYMVKCFA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgccgccgccgccgccgccgtggcggcaccggagcagccgcgccgccggaag
cctgcgccgggacgcggaggcgtggtcctccccgcgggcctctcggaggaggaggcccgt
gtgcgggccatcgcggagatcgtgtcggcgatgggggagctcagtcggcgcggggaggac
gtggacctcaacgagctcaagtccgccgcgtgccggaagtacgggctggcgcgggcaccc
aagctggtggagatgatcgccgcggtgcccgaggccgaccgcgccgcgctgctgccgcgg
ctgcgcgccaagcccgtgcgcacggcgtcgggcatcgccgtcgtcgccgtcatgtcgaag
ccgcaccggtgcccccacatcgccaccaccgggaacatctgcgtgtactgcccgggcggc
cccgactccgacttcgagtacagcacgcagtcctacactggatatgagcctactagcatg
cgtgccattcgggcaaggtacaatccatatgttcaagccagaagcaggatagatcagctc
aagaggctagggcatagtgtggataaggtcgaattcatcttgatgggtgggactttcatg
tccttgccagctgattatcgcgattattttatcagaaatcttcatgatgctttatccggt
cacacttctgcaaatgttgaggaggctgtttgttattcagaacacagtgctgtcaaatgt
attggcatgacaattgagacgagacctgattattgcttggggcctcatctgcgccagatg
ctatcttatggttgtacccgcttagaaattggtgttcagagtacatacgaggatgtcgcc
cgtgacacaaacagaggccacacggtggctgctgttgctgattgcttttgtttggcaaaa
gatgctgggtttaaggtggttgcccacatgatgccagatttacctaatgttggagttgaa
agagacctagaaagtttcagagaattttttgaaagtccagcattccgggccgatggtcta
aagatttatccaacacttgtgattcgtggaactggtctttatgagctctggaaaactggc
agatatagaaattatccacctgagctgttggtggatattgtagctaggattctgtctatg
gtaccaccgtggacacgagtgtatcgggtccagagagatattcctatgcctctcgtaact
tctggtgtcgagaaaggtaacctgcgtgagcttgctttggctcgaatggaggatctaggc
ttgaaatgccgagatgtcagaacccgtgaggcagggattcaggatatccatcacaaaatc
aggccagatgaagtagagcttgtcaggcgtgactatgctgcaaatgagggttgggagacg
ttcctctcttatgaggatacacgacaggatatcctgatcggcctattgcgcttgcgtaaa
tgtggtcgtaatgttacatgccctgaactcgtagggaggtgttcaattgtccgcgaactt
catgtctatggaactgcagtccctgtgcatggtcgtgatgcagacaaactacagcaccag
ggttatggaactctactgatggaagaagcagaaagaattgctcgaagggaacaccgttca
aagaaattggctgtcatttcaggagtcggtactcgccactattaccgcaagttgggttat
gagctagaagggccttacatggtcaaatgttttgcataa

DBGET integrated database retrieval system