KEGG   Setaria italica (foxtail millet): 101771921Help
Entry
101771921         CDS       T02818                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101771921
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101771921
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101771921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 944 aa AA seqDB search
MGSAELEQAKVLSGMDCSKPPSRTWQRRFDDEGKKVAMFSMTMRDMISIVPLIVKALQLQ
VEDSAKGRATVYDPLRKWMDNCYRGVPLGGIGAGSIGRSYRGYFQQFQIFPVTNEEKPIL
ANQFSAFISRPNGKKYSTVLSAPTADLLKGVDKAGIGSWDWKLKEDKCTYHALFPRSWTV
YDGVPDPEIKIACRQISPFIPHNYKESSFPAAVFTFTVHNSGSTPADVTLLFTWANSVGG
KSELTGNHSNSKMKDQDGVSGVLLHHRTAGGHPPVTFAIASQETDGVGVSVCPSFTMGPS
SSGGFTATDMWDQIKKHGSFGHAGAGDAPTAASKPGSSVGAAVAASVAVPAGARRVVSFS
LAWACPEVKFAGGTTYHRRYTKFYGVDGDAAAEQLAHDALLEHMNWESQIEEWQRPILQD
ETLPEWYPIGLFNELYYLNAGGTIWTDGHPPKKAGFGSSGPFSLDTPRVADGAAANVTGG
GGSAVDGIMSAMASAADRSHAASAAFGPALLRGGEENVGQFMYLEGMEYNMYNTYDVHFY
SSFALLALFPQLELSLQRDFAMAVLIHDPRLRHTLDGKTVRRKVLGAVPHDVGLNDPWVE
LNAYMLHDAARWKDLNPKFVLQVYRDAAATGDAAFAAAAWPAVYVAMAYMDQFDRDGDGM
VENDGVPDQTYDIWSVSGVSAYTGGLWVAALQAAAAMARIVGDRAAEAYFMVRYKKARRV
YDGELWNGTYFNYDNSGGATSSSIMADQLAGQWYARACGLEPVVEEAKARSALATVLDYN
VMRVKGGAVGAVNGMRPDGAVDASSTQSKEVWPGVTYAVAAAMVHEGMTESAFRTAKGAH
DAAWGKDGFGYAFQTPEAWTEDGGYRSLHYMRPLGIWAMQWALSPPELHKDLRAAASEES
PADAALGQAQFEKVASMLKLPEEEQPKGYLWAIYNLIRQMVFPA
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgcagagttggagcaagccaaggtgctctcgggcatggattgttcgaaacct
ccatcgaggacttggcagaggagattcgacgatgaaggcaagaaggttgcaatgttcagc
atgaccatgagggatatgatatcaattgtgcccttgattgtcaaagcattgcaattgcaa
gttgaagatagtgcaaaaggccgagctacggtttatgatccactgagaaaatggatggat
aactgctaccgtggagtaccgctcggtgggataggtgcaggaagcatagggagaagctac
agagggtactttcagcaatttcagatattcccagtgacaaatgaagagaaacctatctta
gcaaatcagttttcagcatttatttcgcgcccgaatgggaagaagtactccacggtgttg
tctgcgccgactgcggatctcctcaagggagttgataaagccggtattggatcttgggat
tggaagctgaaggaggacaaatgcacttaccacgccctgtttccaagatcatggacagta
tatgatggtgtgcctgaccctgaaatcaagatcgcctgccgtcagatatcgcccttcatc
cctcacaattacaaagagagcagcttccctgctgcggttttcacgtttacggtgcacaac
tctgggagcacacctgcagatgtgacgctgctcttcacctgggctaactcagttggtggg
aaatcagaactgaccgggaatcatagcaactcaaaaatgaaggatcaggacggtgtcagt
ggcgttctcctgcatcacaggacggccggcgggcaccctccggtgacgttcgcgatcgca
tcccaggagacggacggcgtcggtgtcagcgtctgcccgtcgttcacgatgggcccgtcc
agctccggcggcttcacggcgaccgacatgtgggaccagatcaagaagcacggctcgttc
gggcacgccggcgccggcgacgcgccgacggcggcgtcgaagcccgggtcctccgtcggt
gcggcggtggcggcgtcggtggccgtgccggcgggggcgaggcgggtggtgtccttctcg
ctggcctgggcgtgccccgaagtgaagttcgccggcggcacgacgtaccacaggaggtac
accaagttctacggcgtcgatggcgacgcagctgcagagcaactggctcatgatgctctt
cttgagcatatgaactgggagtcccagatcgaggagtggcagaggccgatcctgcaagac
gaaacgctgcctgaatggtatccaattggtctgttcaacgagctctactacctcaacgct
ggaggcaccatctggacagatggacatcctccgaagaaggccggcttcggttcatccggg
ccgttctccctcgacacgccccgcgttgcagacggcgccgccgccaacgtcaccggcggc
ggcggcagcgcggtggacggcatcatgagcgccatggcatcggcggcggatcgctcccac
gcggcgtcggcagctttcggcccggcgctccttcgcggcggcgaggagaacgtggggcag
ttcatgtacctggaaggcatggagtacaacatgtacaacacctacgacgtccacttctac
tcctccttcgccctcctcgccctcttccctcagctcgagcttagcctgcagcgcgacttc
gccatggccgtcctcatccacgacccgcgcctccgtcacaccctcgacgggaagaccgtc
cgccgcaaggtcctcggcgcggtgccgcacgacgtcgggctcaacgatccatgggtcgag
ctgaacgcgtacatgctccacgacgcggcgcggtggaaggacctcaacccaaagttcgtg
ctccaggtgtaccgcgacgccgcggccacgggcgacgcggcgttcgcggcggcggcgtgg
ccggcggtgtacgtggccatggcgtacatggaccagttcgaccgggacggggacgggatg
gtggagaatgatggcgtcccggaccagacgtacgacatctggtcggtgtccggcgtcagc
gcctacaccggcgggctctgggtcgccgcgctgcaggccgccgccgccatggcgcgcatc
gtcggcgaccgcgccgccgaggcctacttcatggtgaggtacaagaaggcgaggcgcgtg
tacgacggcgagctctggaacgggacctacttcaactacgacaacagcggcggcgcgacg
agctcgtcgatcatggcggaccagctcgccgggcagtggtacgcgcgggcgtgcgggctg
gagccggtggtggaggaggccaaggcccggagcgcgctggccacggtgctcgactacaac
gtgatgcgggtgaagggaggcgccgtcggggcggtgaacgggatgcggcccgacggcgcc
gtggacgcgtcatcgacgcagtccaaggaggtgtggcccggcgtgacgtacgccgtggcg
gcggccatggtccacgagggcatgacggagtccgcgttccggacggcgaagggcgcacac
gacgccgcctggggcaaggacggcttcgggtacgcgttccagacgccggaggcgtggacg
gaggacggcggctaccggtcgctgcactacatgcggccgctgggaatctgggcgatgcag
tgggcgctgtcgccgccggagctccacaaggatctcagggcggcggcctcggaggagtcg
ccggcagacgccgccctggggcaggcgcagttcgagaaggtggcgagcatgctgaagctg
ccggaggaggagcagcccaagggatacctttgggccatctacaatctcattaggcaaatg
gtgttcccagcataa

DBGET integrated database retrieval system