KEGG   Setaria italica (foxtail millet): 101773817Help
Entry
101773817         CDS       T02818                                 

Definition
(RefSeq) pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00040  Pentose and glucuronate interconversions
sita01100  Metabolic pathways
Module
sita_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101773817
Enzymes [BR:sita01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101773817
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 101773817
NCBI-ProteinID: XP_014660726
Position
V
AA seq 396 aa AA seqDB search
MRRYIEPTLYHVSRMVSNSLAMAKKLPGAPSPSPSSAQAETKTEATAAPRQPFVGYGQMV
KGFPRWVRPGDRRLLQAPASGIKADAVVAKDGSGNFTTVAAAVAAAPTNSRRRYVIYIKA
GAYIENVDVGKKHVNLMFVGDGIGKTVIKGSRNVIDGSTTFRSATVALVGNNFLGRDLTI
ENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDIYGTIDFIFGNA
AVVFQSCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAASDLAGQESSTKTYL
GRPWKQYSRTVFLQSELDSLIDPAGWLEWNGSFALDTLYYGEYMNTGAGAGTAGRVKWKG
YRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgctacatcgagccgacgctctaccacgtctcccgcatggtcagcaactcgctc
gccatggccaagaagctgcccggcgcgccctcgccgtcgccatcgtcggcgcaggcggag
acgaagacggaggcgaccgcggcgccgcggcagccgttcgtggggtacgggcagatggtg
aaggggttcccgcggtgggtgcgtcccggggaccgtcggctgctgcaggcccccgcatcg
ggcatcaaggccgacgcggtggtggcgaaggacgggagcgggaacttcacgacggtggcg
gcggcggtggcggcggcgccgaccaactcgcggaggcggtacgtgatctacatcaaggcc
ggggcgtacattgagaacgtggatgtcgggaagaagcacgtgaacctgatgttcgtcggc
gacggcatcggcaagacggtcatcaagggcagccgcaacgtcatcgacggctccacaacc
ttccgctccgccacggtcgctcttgtgggcaacaacttcctgggccgcgacctgacgatc
gagaactcggcgggcccgtcgaagcaccaggcggtggcgctccgggtgggcgcggacctc
tccgccttctaccggtgcagcttcgtgggttaccaggacaccctgtacgtgcactccctc
cggcagttcttccgcgactgcgacatctacggcaccatcgacttcatcttcggcaacgcc
gccgtcgtcttccagagctgcaacctctacgcccggaagccgctcccgaaccagagcaac
atcttcacggcgcagggccgggaggaccccaaccagaacacgggcatctccatccagcgc
tgcaaggtggcggcggcgtccgacctcgccggccaggagtcgtcgaccaagacctacctg
gggcggccgtggaagcagtactcccgcacggtgttcctgcagtcggagctggactcgctg
atcgaccccgccgggtggctcgagtggaacggcagcttcgcgctggacacgctctactac
ggcgagtacatgaacacgggcgccggcgccggcacggccgggagggtcaagtggaagggg
taccgcgtcatcaccagcgcggccgaggccagcgcattcaccgtcgggtcattcatcgac
ggcgacgtctggctcgccggcacgtccatccccttcaccactggcttgtga

DBGET integrated database retrieval system