KEGG   Setaria italica (foxtail millet): 101773845Help
Entry
101773845         CDS       T02818                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sita00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sita00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 927 aa AA seqDB search
MPSGNLLSRRKRSWRANEFVSRSTLQLLDFDDGSPPEHAWRRKLSSHANRLKEFNVTFRE
AIRMMKLGLRLWSYIREEASHGRKAPIDPFTRESNKPSASQGVPLGGMGTGSISRGFRGE
FKHWQITPGYCEMSPVMANQFSIFVARGGNKKYASVLAPGQLDGLKKSSDDGISSWDWKL
KGDRSTYHALFPRAWTVYDGEPDPELKVSCRQISPFIPHNYQESSLPTSVFVYTLVNTGK
ERAKVSLLMTWANSIGGLSHHTGGHVNEPFIGENGVSGVLLHHKTANNNPPVTFAIAACE
NQNVNVTVLPVFGLSGESSVTAREMWGTMVQDGSFDRDNFNAGASMPSSLGDTVCAAVSA
STWVEPHGRCTVVFALAWSSPKVKFKKGSTYYRRYTKFYGTSPRSAVNLVQDALMKYKYW
EEAIDKWQTPILSDERLPEWYKITLFNELYFLVAGGTVWIDSESLVVDADNKSNSSLLED
SDSSLRDSSCNSTVPLIGFDPHEIDDKENVGKFLYLEGIEYFMWCTYDVHFYASFALLDL
FPKIELSIQRDFARAVLREDNSRVRFLADGTWGIRKVIGAVAHDLGAHDPWHELNAYNIH
DTSRWKDLNPKFVLQIYRDFSATGDMSFGKDVWPAVCTAMEYMEQFDHDGDGMIENDGFP
DQTYDAWTVQGVSAYCGCLWLAALQAAAALARSLGHVDYAERCMIRFAKAKSVFEARLWN
GSYFNYDSGTSYSSRSIQADQLAGQWYTASSGLPPLFDEDRIKCTLQKIFDYNVMRVKGG
RMGAVNGMHPNGKVDETCMQSREIWTGVTYSLAATMLLHGMEHQAFTTAEGIYIAGWSEE
GYGYWFQTPEAWTVDGHYRSLIYMRPLAIWAMQCALSPPKSILEAPKVNTMDRAHMSPGT
LQFLQDSVRKITPKNGCFGNTVFNWDC
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcggaaacttgctctcccggaggaagcgctcgtggcgtgccaatgagttcgtg
agcaggagcaccctgcaactgcttgacttcgatgatggttcaccaccagagcatgcatgg
agaaggaaactaagtagtcatgctaatagattgaaagagttcaatgttacattcagagaa
gcaattagaatgatgaaacttggtctccgactttggtcatatattcgggaagaagcttct
cacgggaggaaagcaccaatcgaccccttcactagagagagcaacaaaccctcagcatca
caaggagtacctcttggtgggatggggactggcagcatttcaagaggctttaggggagaa
ttcaagcattggcagataactcctggttattgtgaaatgtcacctgtgatggccaatcaa
ttttcgatctttgtcgctcggggaggaaacaagaaatatgcttcagttttggcccctggt
caacttgatggtttgaagaaatctagtgatgatggtatatcatcctgggattggaaatta
aagggtgatcgttcaacataccatgctctgtttcctcgagcatggactgtttatgatggc
gaaccagatccggagctgaaagtatcttgccgtcaaatatcaccatttattccacacaac
tatcaagagagcagccttcctacctctgtttttgtatacactctagtgaataccggaaag
gaaagggcaaaagttagcctattgatgacctgggcgaattctataggaggactttcacat
catactggcggtcatgtaaatgagccattcataggagaaaatggagtttctggcgttctt
ctacatcacaagacagccaataataatcctcctgtaacatttgcaattgcggcatgtgaa
aaccaaaatgtaaacgtcacagtgttgcctgtttttgggctttctggagaaagttctgtt
actgccagggaaatgtggggcacaatggtccaggatggttcctttgaccgagataatttc
aatgctggtgccagcatgccttcttcactgggtgatacagtttgtgcagcagtttctgct
tccacctgggttgaaccacatggaagatgtacagtcgtatttgcgttggcttggtcttct
cctaaggttaaatttaaaaagggaagtacatactacaggagatatacaaaattctatgga
acttcgccaagatcagctgtaaatttggtacaagacgctttgatgaagtataaatattgg
gaagaggcgattgataagtggcagaccccgattctcagtgatgagaggcttccagaatgg
tacaaaattactctcttcaatgagctgtacttcctagttgctggaggaactgtttggatt
gatagtgaatctttggtggttgatgctgataacaagtcaaattcaagtctccttgaggac
agtgattcatcacttcgtgatagcagttgcaattctacagttcccctaatcggttttgac
ccacatgagattgatgacaaagaaaacgttgggaagtttttgtacctggaaggaatagag
tacttcatgtggtgcacttacgacgtacacttctatgcctcttttgctcttttggatctg
tttcctaagattgaattaagcattcaacgtgattttgctagagctgttttgcgggaagat
aacagtagagtcagatttcttgctgatggtacctgggggattcgtaaagtaatcggagct
gttgcccatgaccttggagcacatgatccttggcatgaattgaatgcttataacatccat
gacacaagtagatggaaagatctcaatcccaagttcgtgcttcagatttacagagatttt
tctgcaacaggtgatatgtcatttggcaaggatgtctggcctgcagtttgtactgctatg
gaatatatggaacaatttgatcatgatggtgatggtatgattgaaaatgatggatttcct
gatcaaacttatgatgcttggacagttcaaggagtaagtgcgtactgtggttgcctttgg
cttgctgccctgcaagctgcagccgcactggcccgcagccttggacatgttgactatgct
gagaggtgcatgataagatttgcaaaagctaaatccgtatttgaagccagattatggaat
ggttcatacttcaattatgacagtggaacaagttacagtagccgttccatccaggcagac
cagctggctggacaatggtatactgcatcgtcagggttgcctcctctatttgatgaggat
aggataaaatgcacgcttcagaaaatatttgactataatgtgatgagggtgaaaggagga
cgtatgggagccgtgaatggtatgcatccgaacgggaaggtagatgaaacctgtatgcag
tcaagggaaatatggacaggagtaacatatagtttagctgcaacgatgctgcttcatgga
atggagcatcaggccttcactactgcagaaggcatttatattgcaggatggtctgaagag
ggctatgggtactggtttcaaactccagaagcatggacagtggatggccactacaggtca
ttgatatacatgcgcccccttgcaatctgggcaatgcagtgtgccttgtccccgccaaag
tcgatactagaggcgccgaaggttaacacaatggacagggctcacatgtctccaggcacg
ctccagtttctccaggatagtgtcaggaagattacgcccaagaacggttgtttcggaaac
accgtatttaactgggattgttga

DBGET integrated database retrieval system