KEGG   Setaria italica (foxtail millet): 101774505Help
Entry
101774505         CDS       T02818                                 

Definition
(RefSeq) 1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00500  Starch and sucrose metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101774505
Enzymes [BR:sita01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101774505
Exosome [BR:sita04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101774505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 101774505
NCBI-ProteinID: XP_004952629
UniProt: K3YQ08
Position
I
AA seq 843 aa AA seqDB search
MAVAPALAVSGAALGGAVARAPRPTGGGGERRRGSERPSPSLVFGRMGTFVVPRGAPVGG
GSRRRGAMRAAAASGKVVVPEGENDGLTSSADSAQFQSDELEVPDITEDQIESSETMHVA
READAQALNREVLGSAPQVKPRTVPPPGDGQKIFQIDSMLQGYKYHLEYRYSLYRRIRSD
IDEHEGGLEAFSRSYEKFGFNRSAEGVTYREWAPGAHSAALVGDFNNWDPNADRMSKNEF
GVWEVFLPNNADGSSPIPHGSRVKVRMDTPSGIKDSIPAWIRYSVQAPGAIPYDGIYYDP
PEEVKHVFKHPQPKRPKSLRIYETHVGMSSPEPKINTYANFRDEVLPRIKKLGYNAVQIM
AIQEHSYYGSFGYHVTNFFAPSSRFGTPEDLKSLIDKAHELGLLVLMDVVHSHASSNTLD
GLNGFDGTDTHYFHSGPRGHHWMWDSRLFNYGNWEVIRFLLSNARWWLEEYKFDGFRFDG
VTSMMYTHHGLQVTFTGNFNEYFGFATDVDAVVYLMLVNDLIHGLYPEAVTIGEDVSGMP
TFALPVHDGGVGFDYRLHMAVADKWIELMKQSDESWKMADIVHTLTNRRWLEKCVTYSES
HDQALVGDKTIAFWLMDKDMYDFMALDRPSTPTIDRGIALHKMIRLITMGLGGEGYLNFM
GNEFGHPEWIDFPRGPQRLPSGKFIPGNNNSYDKCRRRFDLGDADYLRYHGMQEFDRAMQ
HLEEKYGFMTDDHQYISRKHEEDKVIVFEKGDLVFVFNFHCNNSYFDYRVGCRRSGVYKV
VLDSDAGLFGGFGRIHHTAEHFTDGSHDNRPHSFSVYTPSRTCVVYAPADTIVPESSEEV
ISK
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcgccggcgttggcggtctccggggccgcgctcggcggggctgtggcgagg
gctccccggcccaccggcggcggcggggagcggaggcgcgggtcggagcgcccgtcgccg
tcgctggtcttcggccgcatgggcaccttcgtcgtccctcggggtgctccggttggagga
ggttcgcggaggcgcggggccatgcgcgcggcggccgcgtccgggaaggtggtggttccc
gagggcgagaacgacggacttacgtcttcggccgactcggctcagttccagtccgacgaa
ttggaggtaccagacatcactgaagatcagatcgagtcctcagagacaatgcacgttgcc
cgtgaggctgatgctcaagccttgaacagagaggtactaggatcagctccccaggtgaaa
ccacgaactgttccaccaccaggagatgggcagaaaatattccagattgactccatgctg
caaggctataagtaccatcttgagtatcggtacagcctctataggagaatccgttcagat
attgatgagcatgaaggaggcttggaagccttctcccgtagttatgagaagtttggattt
aatcgcagtgctgaaggtgtcacctatcgagaatgggctcctggagcacattctgctgca
ttggtgggcgacttcaacaactgggatccaaatgcagaccgtatgagcaaaaatgagttt
ggtgtttgggaggtttttctgcctaacaacgcagatggttcatcacctattcctcatggt
tctcgcgtaaaggtgagaatggataccccatcagggataaaggactcaattcctgcctgg
atcaggtactcagtgcaggccccaggagcaataccttatgatgggatttattatgatcct
cctgaagaggtgaagcatgtgttcaagcatcctcaacctaaacggccaaaatcattgagg
atatatgaaacacatgttggaatgagtagcccggaaccgaagatcaacacatatgcaaac
ttcagggatgaggtccttccaagaataaaaaaacttggatacaatgcagtgcaaataatg
gcaatccaagagcactcatattatggaagctttggataccatgttactaatttttttgca
ccaagtagtcgttttggaaccccagaagatttgaagtctttgattgataaagcacatgag
cttggtttgcttgtgctcatggatgttgttcacagtcatgcgtcaagtaatactcttgat
ggattgaatggttttgatggtacggatacacattactttcatagtggtccacgaggccat
cactggatgtgggattctcgtctgttcaactatggaaattgggaggttataagatttctt
ctctccaatgctagatggtggctcgaggaatataagtttgatggtttccgttttgatggt
gtgacctccatgatgtacactcaccatggattacaagtaacatttacggggaacttcaat
gagtattttggctttgccaccgatgtggatgcagtggtttacttgatgttggtaaatgat
ctaattcacggactttatcctgaggctgtaaccattggtgaagatgtgagtggaatgcct
acatttgcccttcctgttcatgatggtggagtaggttttgactaccggctgcatatggct
gtggctgacaaatggattgaattgatgaagcaaagtgatgaatcttggaagatggccgat
attgtgcacacattgacaaatagaaggtggttagagaagtgtgttacttattctgaaagt
catgatcaagcactggttggtgataagactattgcattttggttgatggacaaggatatg
tatgatttcatggctctcgacagaccttcaacacctaccattgaccgtgggatagcattg
cataagatgatcagacttatcacaatgggtttaggaggagagggctatcttaatttcatg
gggaatgagtttggacatcctgaatggatagattttccaagaggtccgcaaagacttcca
agtggtaagtttattccaggaaataacaacagttatgacaaatgccgtcgaagatttgac
ctgggtgacgcggactaccttaggtaccatggtatgcaagagtttgatcgggcaatgcaa
catcttgaggaaaaatatggattcatgactgatgatcaccagtacatttctcggaaacac
gaggaggacaaggtgattgtattcgaaaagggagatttggtatttgtgttcaacttccat
tgtaacaacagctattttgactaccgtgttggctgccggagatctggggtgtataaggtg
gtcttggactcagacgctggactcttcggtggattcggcaggatccatcacaccgcagag
cacttcacggacggttcgcatgacaacaggccccattcgttctcggtgtatacaccaagc
agaacctgcgtcgtctatgctccagcggacacaatcgtgccagaaagcagcgaggaagtt
attagcaagtaa

DBGET integrated database retrieval system