KEGG   Setaria italica (foxtail millet): 101774505Help
Entry
101774505         CDS       T02818                                 

Definition
1,4-alpha-glucan-branching enzyme 2, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101774505
Enzymes [BR:sita01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101774505
Exosome [BR:sita04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101774505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 797 aa AA seqDB search
MGTFVVPRGAPVGGGSRRRGAMRAAAASGKVVVPEGENDGLTSSADSAQFQSDELEVPDI
TEDQIESSETMHVAREADAQALNREVLGSAPQVKPRTVPPPGDGQKIFQIDSMLQGYKYH
LEYRYSLYRRIRSDIDEHEGGLEAFSRSYEKFGFNRSAEGVTYREWAPGAHSAALVGDFN
NWDPNADRMSKNEFGVWEVFLPNNADGSSPIPHGSRVKVRMDTPSGIKDSIPAWIRYSVQ
APGAIPYDGIYYDPPEEVKHVFKHPQPKRPKSLRIYETHVGMSSPEPKINTYANFRDEVL
PRIKKLGYNAVQIMAIQEHSYYGSFGYHVTNFFAPSSRFGTPEDLKSLIDKAHELGLLVL
MDVVHSHASSNTLDGLNGFDGTDTHYFHSGPRGHHWMWDSRLFNYGNWEVIRFLLSNARW
WLEEYKFDGFRFDGVTSMMYTHHGLQVTFTGNFNEYFGFATDVDAVVYLMLVNDLIHGLY
PEAVTIGEDVSGMPTFALPVHDGGVGFDYRLHMAVADKWIELMKQSDESWKMADIVHTLT
NRRWLEKCVTYSESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPTIDRGIALHKMIRL
ITMGLGGEGYLNFMGNEFGHPEWIDFPRGPQRLPSGKFIPGNNNSYDKCRRRFDLGDADY
LRYHGMQEFDRAMQHLEEKYGFMTDDHQYISRKHEEDKVIVFEKGDLVFVFNFHCNNSYF
DYRVGCRRSGVYKVVLDSDAGLFGGFGRIHHTAEHFTDGSHDNRPHSFSVYTPSRTCVVY
APADTIVPESSEEVISK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccttcgtcgtccctcggggtgctccggttggaggaggttcgcggaggcgcggg
gccatgcgcgcggcggccgcgtccgggaaggtggtggttcccgagggcgagaacgacgga
cttacgtcttcggccgactcggctcagttccagtccgacgaattggaggtaccagacatc
actgaagatcagatcgagtcctcagagacaatgcacgttgcccgtgaggctgatgctcaa
gccttgaacagagaggtactaggatcagctccccaggtgaaaccacgaactgttccacca
ccaggagatgggcagaaaatattccagattgactccatgctgcaaggctataagtaccat
cttgagtatcggtacagcctctataggagaatccgttcagatattgatgagcatgaagga
ggcttggaagccttctcccgtagttatgagaagtttggatttaatcgcagtgctgaaggt
gtcacctatcgagaatgggctcctggagcacattctgctgcattggtgggcgacttcaac
aactgggatccaaatgcagaccgtatgagcaaaaatgagtttggtgtttgggaggttttt
ctgcctaacaacgcagatggttcatcacctattcctcatggttctcgcgtaaaggtgaga
atggataccccatcagggataaaggactcaattcctgcctggatcaggtactcagtgcag
gccccaggagcaataccttatgatgggatttattatgatcctcctgaagaggtgaagcat
gtgttcaagcatcctcaacctaaacggccaaaatcattgaggatatatgaaacacatgtt
ggaatgagtagcccggaaccgaagatcaacacatatgcaaacttcagggatgaggtcctt
ccaagaataaaaaaacttggatacaatgcagtgcaaataatggcaatccaagagcactca
tattatggaagctttggataccatgttactaatttttttgcaccaagtagtcgttttgga
accccagaagatttgaagtctttgattgataaagcacatgagcttggtttgcttgtgctc
atggatgttgttcacagtcatgcgtcaagtaatactcttgatggattgaatggttttgat
ggtacggatacacattactttcatagtggtccacgaggccatcactggatgtgggattct
cgtctgttcaactatggaaattgggaggttataagatttcttctctccaatgctagatgg
tggctcgaggaatataagtttgatggtttccgttttgatggtgtgacctccatgatgtac
actcaccatggattacaagtaacatttacggggaacttcaatgagtattttggctttgcc
accgatgtggatgcagtggtttacttgatgttggtaaatgatctaattcacggactttat
cctgaggctgtaaccattggtgaagatgtgagtggaatgcctacatttgcccttcctgtt
catgatggtggagtaggttttgactaccggctgcatatggctgtggctgacaaatggatt
gaattgatgaagcaaagtgatgaatcttggaagatggccgatattgtgcacacattgaca
aatagaaggtggttagagaagtgtgttacttattctgaaagtcatgatcaagcactggtt
ggtgataagactattgcattttggttgatggacaaggatatgtatgatttcatggctctc
gacagaccttcaacacctaccattgaccgtgggatagcattgcataagatgatcagactt
atcacaatgggtttaggaggagagggctatcttaatttcatggggaatgagtttggacat
cctgaatggatagattttccaagaggtccgcaaagacttccaagtggtaagtttattcca
ggaaataacaacagttatgacaaatgccgtcgaagatttgacctgggtgacgcggactac
cttaggtaccatggtatgcaagagtttgatcgggcaatgcaacatcttgaggaaaaatat
ggattcatgactgatgatcaccagtacatttctcggaaacacgaggaggacaaggtgatt
gtattcgaaaagggagatttggtatttgtgttcaacttccattgtaacaacagctatttt
gactaccgtgttggctgccggagatctggggtgtataaggtggtcttggactcagacgct
ggactcttcggtggattcggcaggatccatcacaccgcagagcacttcacggacggttcg
catgacaacaggccccattcgttctcggtgtatacaccaagcagaacctgcgtcgtctat
gctccagcggacacaatcgtgccagaaagcagcgaggaagttattagcaagtaa

DBGET integrated database retrieval system