KEGG   Setaria italica (foxtail millet): 101774534Help
Entry
101774534         CDS       T02818                                 

Definition
probable histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101774534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 467 aa AA seqDB search
MALKQKGTDAAAAADPKKRRRVGFSGIDAGVEANECMKVFLARNSDEVGSEDCTSIQPFD
LNHFFGEDGKIYGYKNLKINVWISAISFHGYADISFDETSDGGKGITDLNTVLQSIFGES
LVEKEEFMQTFSKECEYIRDVVTNGSAIKHNGTNESDPAVEIVRVELQGVAAFLYSRLVP
LVLLLVEGSTPIDIGEHGWEMLLVVKRTTQESVSKFQLLGFAAVHNFYHYPESNRLRISQ
ILVLPPHQGEGHGLRLLEAINSIAQSENIYDVTIEDPSDYLQYVRSSIDCLRLLTLDPIK
PALSAMVSSLKETNLSKRTCSLKMVPPADLTETVRQKLKINKKQFLRCWEILIYLSLDSE
DRKSMDNFRACIYDRTKGEILGGATGTNGKRLVQMSSSVNEEVSFAVYWTQEGGDADDQT
VEQQPEDLKTQEQQLNELVDNQMEEIVGVAKNVSSRGKDKLADLAAL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaagcagaagggcacagacgccgccgccgccgccgaccccaagaagcgccgc
cgcgtcggcttctccggcatcgatgctggagtcgaggcaaatgagtgtatgaaagtgttt
ctggcaagaaactctgatgaggtgggctctgaagactgcacttctattcaaccatttgac
ctaaaccatttttttggtgaagatggaaagatatatggttacaaaaatcttaagataaat
gtgtggataagtgcaatatcattccatggatatgctgatatttcatttgacgaaacatct
gatggaggaaaaggaataactgatctaaatactgttcttcagagcatttttggagaaagc
ttggtcgaaaaagaggaatttatgcaaaccttttcaaaggaatgcgaatacatcagagat
gtggtgacaaatggtagtgccataaagcataacggcacaaatgaatcagatccagcagtt
gagattgttcgagttgaactccaaggtgttgctgcattcctttattctcgcctggtgccg
cttgttctgcttctagttgaaggttccacgcctatagatattggggaacatggatgggaa
atgcttctggtagtaaaaaggacaacacaagagtccgtttcaaaatttcaactgctaggt
tttgcagctgtgcataatttttatcattaccctgagagcaatcggttgcggatcagccag
atactggtgttgccacctcatcagggtgaaggccatggccttcgtcttcttgaggcaatc
aattctattgcacaatctgagaacatatatgacgtaaccatagaagacccttcagattat
ctgcagtatgtgcgttcatctatcgactgcctccgtcttctcacacttgatccaatcaaa
ccagcgctcagtgctatggtatcatctctgaaggagaccaacctttcaaaaaggacttgc
agcttgaagatggttccgccagctgacctgaccgagactgtccggcagaagctgaagatc
aacaagaaacagttcctgcggtgctgggaaattctgatctatctaagccttgattctgag
gaccgtaagagcatggacaacttcagggcctgcatatatgaccgcaccaagggtgaaatc
cttggcggtgccactggaaccaatgggaagcgtctggtgcagatgtcaagcagtgtgaac
gaggaggtgtcctttgctgtgtactggacacaagagggtggggatgctgacgaccagaca
gttgagcagcaaccagaagatctcaagacccaggagcagcagcttaatgagcttgtggac
aaccaaatggaggagattgttggggttgcgaagaatgttagctcgcgtggtaaggataaa
ctggcagacctggctgctctttga

  All links  
No link information was found.   
DBGET integrated database retrieval system