KEGG   Setaria italica (foxtail millet): 101774669Help
Entry
101774669         CDS       T02818                                 

Definition
pectinesterase 3-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sita00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sita00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 598 aa AA seqDB search
MAPPTVRPKLRPAAAKLPLTATVLSLALLLLPLGFVATHRAFSGGVAVSTSATGDERHRE
ERVLLAGNKDDGNADAAAAAEHAAAVDRHCAGTLHREVCASTLASIPNLARKPLRDVISD
VVARAAAAVRASSSNCSSYLRRPRGLRVRDRLALSDCLELFGRTLGQLGTAADELSAGNR
TAEESIAGVQTVLSAALTNQYTCLEGFAGPSASEDGRVRPYIQGRIYHVAHLVSNSLAML
RRLPQRRRRRGREALEGYGRVRRGFPSWVSAGDRRRLLEPSAGAADLVVAKDGSGNFTTV
GEAVAAAPNNSESRFVIYIKAGGYFENVEVGPEKTNLMFVGDGMWKTVIKASRNVVDNST
TYRSATLAVVGTGFLARDLTVENAAGPSKHQAVALRVNADLSAFYRCSFAGYQDTLYAHS
LRQFYRDCDVYGTVDFVFGDAAAVLQGCSLYARRPDPRQKNVFTAQGREDPNQNTGIVVQ
GGKVAAAADLIPVLANFTSYLGRPWKLYSRTVFIQTKMEELIHPRGWLEWNGSFALDTLY
YAEYMNRGPGANTSARVDWPGYHVLTNATDATNFTVLNFIQGDLWLNSTAFPYTLGLS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcccactgtgaggccaaagctcagaccagccgccgccaagctccccctcacc
gccaccgtcctctccctcgccctcctcctcctgccgcttggcttcgtcgccacccacagg
gcattctccggtggcgtcgccgtgtcgacgtccgccaccggcgacgagcgccaccgcgaa
gaacgggtgcttcttgctggtaataaggacgacggcaatgccgacgccgccgcggcggcg
gagcacgcggccgccgtggaccggcactgcgccggcacgctgcaccgcgaggtgtgcgcg
tcgacgctggcgtccatcccgaacctcgcgcggaagccgctgcgtgacgtgatctccgac
gtggtggcgcgcgcggcggcggcggtgcgcgcgtcgtcgtccaactgctcgtcctacctc
cgccgtccccgtggcctgcgcgtgcgcgaccgcctggcgctgtccgactgcctggagctg
ttcgggcgcacgctggggcagctggggacggcggcggacgagctgtcggcggggaaccgc
accgcggaggagtccatcgccggcgtccagaccgtgctgtcggccgccctgaccaaccag
tacacctgcctggagggcttcgcgggcccgtcggcgtcggaggacgggcgcgtccggccc
tacatccagggccgcatctaccacgtggcccacctggtgtccaactccctcgccatgctg
cgccgcctcccgcagcgccgccgccggcgcgggcgcgaggcgctggaggggtacgggcgg
gtgcggcgcgggttcccgtcgtgggtgtcggcgggggaccggaggcggctgctggagccg
tcggctggcgcggcggacctggtggtggccaaggacgggagcgggaacttcacgacggtg
ggggaggcggtggcggcggcgcccaacaacagcgagtcgcggttcgtgatctacatcaag
gcgggagggtacttcgagaacgtggaggtggggccggagaagacgaacctgatgttcgtc
ggcgacgggatgtggaagacggtgatcaaggccagccgcaacgtcgtcgacaactccacc
acctaccgctccgccacgctagcggtggtgggcacgggtttcctggcgcgcgacctgacg
gtggagaacgcggcggggccgagcaagcaccaggcggtggccctccgcgtcaacgccgac
ctctccgccttctaccgctgcagcttcgcggggtaccaggacacgctctacgcccactcc
ctccgccagttctaccgcgactgcgacgtctacggcaccgtcgacttcgtcttcggcgac
gccgccgccgtgctccagggctgcagcctctacgcgcgccgaccggacccccgccagaag
aacgtcttcaccgcgcaggggagggaggaccccaaccagaacaccggcatcgtcgtgcag
ggcggcaaggtcgccgccgccgcagacctcatccccgtcctcgcaaacttcacctcctac
ctcggacggccgtggaagctctactcgcggacggtgttcatacagaccaagatggaggag
ctcatccaccccagggggtggctcgagtggaacggcagcttcgcgctggacacgctctac
tacgccgagtacatgaaccgtggacccggcgccaacacgtcggccagggttgactggccc
ggctaccacgtcctcaccaacgccaccgacgccaccaacttcaccgtgctcaacttcatt
cagggagacctctggctcaactccacagccttcccatacacattgggcttgagctag

DBGET integrated database retrieval system