KEGG   Setaria italica (foxtail millet): 101775308Help
Entry
101775308         CDS       T02818                                 

Definition
putative pectinesterase/pectinesterase inhibitor 22-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101775308
   00500 Starch and sucrose metabolism
    101775308
Enzymes [BR:sita01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101775308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 589 aa AA seqDB search
MAPSATSATNFQLLLMLLLLATARRGNAAAVFAGLSFESEGEAEAFEDALLRQACFNVSV
GGREACVSRLDTARGGAGSGPVPVLRAALRDTLGEAVGAAGAVRGLASLSNHAREEMAVR
DCVELLGYSVDELGWALDAMAEAGDGGVEPDAPGSAAAARRAEDDLHAWLSAALGNQDTC
VEGFRGTDGRLMRRVEAAVAQLTQLVSNLLSMHKRLRSITPLRHAPPGSNGTGGAAADPG
SELPPWVMDVEGEGGKDEEPKPMPKSARAGGSKPTRVDVVVAQDGSGRYRTVSEAVARAP
SHSKRKYVIYVKRGVYHENVEVRKKKTNIVLVGEGMGETVISGSRSFSGGWTTFRSATFA
VAGAGFVARDLTIRNTAGPAAHQAVALRVDSDRSAFFRVAVEGYQDTLYAHSLRQFYRDC
RVAGTVDFVFGNGIAVLQRTLVATLPLAPGQTGSVTAQGRRDPNQNTGFAFHGCVVEAAH
PTFLGRPWKPFSRVVVMESYLGPGVQARGWLEWAATGAGEHAVALATLFYGEYRNYGPGA
GVAGRVRWPGYHAIVDAAVAGRFTVRRFIDGLAWLPGTGVTFTADLFRK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtctgctacgagtgccaccaacttccagttgctgctgatgctcctgctcctc
gctaccgcgcgacgcggcaacgccgccgcggtgttcgccggcctgtcgttcgagagcgag
ggcgaggcggaggccttcgaggacgcgctgcttcggcaggcgtgcttcaacgtctccgtg
ggcgggcgcgaggcctgcgtgtcgcgcctcgacacggcgcggggcggcgccggcagcggg
cccgtgccggtgctgcgcgccgcgctccgcgacacgctcggcgaggccgtgggcgccgcg
ggggcggtcagggggctcgcctcgctgtccaaccacgcgcgcgaggagatggcggtgcgc
gactgcgtcgagctgctgggatactccgtcgacgagctcggctgggcgctcgacgccatg
gccgaggccggcgacggcggcgtcgagccggacgcgcccggctccgcagcggcggcgcgg
cgcgcggaggacgacctccacgcgtggctcagcgcggcgctgggcaaccaggacacctgc
gtcgagggcttccgcggcactgacggccgcctgatgcgccgcgtcgaggcggccgtggcg
cagctcacgcagctggtcagcaacctcctctccatgcacaagcgcctgcgcagcatcacg
ccgctgcgccacgctccgccaggaagcaacggcacaggcggcgccgccgctgaccccggc
tcggagctgccgccgtgggtgatggacgtcgagggcgaaggcggcaaggacgaggaaccc
aagcccatgcccaagagcgcccgcgccggcggcagcaagccgacgcgcgtagacgtcgtg
gtggcgcaggacggcagcgggcggtaccggaccgtcagcgaggcggtggcgcgggcgccg
agccacagcaagcggaagtacgtgatctacgtgaagcgaggcgtgtaccacgagaacgtg
gaggtgaggaagaagaagaccaacatcgtgcttgtcggcgaaggcatgggcgagacggtg
atctccggcagccggagcttctccggcggctggaccaccttccggagcgccacattcgcg
gtggccggcgcggggttcgtcgcgcgggacctgacgatccgcaacacggcggggccggcg
gcgcaccaggcggtggcgctgcgcgtggactctgaccgctccgccttcttccgcgtggcc
gtggaggggtaccaggacacgctgtacgcgcactccctccggcagttctaccgcgactgc
cgcgtcgccgggacggtggacttcgtcttcggcaacggcatcgccgtgctccagcgcacc
ctcgtcgccacgctgccgctggcgcccgggcagacgggcagcgtcaccgcgcagggccgg
agggacccgaaccagaacacgggcttcgccttccacggctgcgtggtggaggccgcgcac
ccgacgttcctgggccggccgtggaagcccttctcgcgggtggtggtcatggagtcctac
ctgggccccggcgtccaggcccgcgggtggctcgagtgggccgccaccggcgccggggag
cacgccgtcgcgctcgccacgctgttctacggggaatacaggaactacgggcccggggcg
ggcgtcgctggccgggtgaggtggcccgggtaccacgcgatcgtcgacgccgccgtcgcc
ggcaggttcaccgtccggcggttcatcgacgggctcgcctggctgcccggcaccggcgtc
accttcacggccgacctgttcaggaagtga

DBGET integrated database retrieval system