KEGG   Setaria italica (foxtail millet): 101779065Help
Entry
101779065         CDS       T02818                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101779065
Peptidases [BR:sita01002]
 Cysteine Peptidases
  Family C86
   101779065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 198 aa AA seqDB search
MEPGAKSEAKQGEAGSGAVGGGGGGKVYHERQRLQFCLLHALNNLMQEKECFTRAELDRI
AGNLVLSDPNKDQWTPLSFIFRPHHNVVTGNYDVNVLIAALEARKKKVVWHDRRKGASSI
ELDAEVLVGLMINVPLRRFRGLWTGRHWVAIRSIDGTWFNLDSDLSEPKQFKDKENVIAF
LDSILNQGGELMVVLQDE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggggccaaatcggaagcgaagcaaggggaggcgggatccggcgcggtggga
ggcggcggcggcggcaaggtgtatcacgagaggcagaggttgcaattctgtctgctccac
gctctcaacaaccttatgcaggaaaaggaatgtttcacccgagctgagttggacaggatt
gctggaaatcttgttcttagtgatccaaacaaggaccaatggactcctctatctttcatt
tttagacctcaccacaatgtggtaactgggaactatgatgtaaatgttctcatcgcggca
ttagaagctagaaagaagaaggtggtttggcatgatcgtcgaaaaggagcatcatcaatc
gagctggatgcagaagtgttggtaggccttatgatcaatgtgcctttgaggaggttcagg
ggcctctggaccggcaggcattgggtagcaattcgaagcattgatggtacctggtttaat
ttggatagtgatctttctgaacccaagcaatttaaggacaaagaaaatgtgattgcattc
cttgacagcatactcaatcaaggtggagaactcatggttgtgctgcaagatgaataa

DBGET integrated database retrieval system