KEGG   Setaria italica (foxtail millet): 101779065Help
Entry
101779065         CDS       T02818                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
sita  Setaria italica (foxtail millet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 198 aa AA seqDB search
MEPGAKSEAKQGEAGSGAVGGGGGGKVYHERQRLQFCLLHALNNLMQEKECFTRAELDRI
AGNLVLSDPNKDQWTPLSFIFRPHHNVVTGNYDVNVLIAALEARKKKVVWHDRRKGASSI
ELDAEVLVGLMINVPLRRFRGLWTGRHWVAIRSIDGTWFNLDSDLSEPKQFKDKENVIAF
LDSILNQGGELMVVLQDE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggagccgggggccaaatcggaagcgaagcaaggggaggcgggatccggcgcggtggga
ggcggcggcggcggcaaggtgtatcacgagaggcagaggttgcaattctgtctgctccac
gctctcaacaaccttatgcaggaaaaggaatgtttcacccgagctgagttggacaggatt
gctggaaatcttgttcttagtgatccaaacaaggaccaatggactcctctatctttcatt
tttagacctcaccacaatgtggtaactgggaactatgatgtaaatgttctcatcgcggca
ttagaagctagaaagaagaaggtggtttggcatgatcgtcgaaaaggagcatcatcaatc
gagctggatgcagaagtgttggtaggccttatgatcaatgtgcctttgaggaggttcagg
ggcctctggaccggcaggcattgggtagcaattcgaagcattgatggtacctggtttaat
ttggatagtgatctttctgaacccaagcaatttaaggacaaagaaaatgtgattgcattc
cttgacagcatactcaatcaaggtggagaactcatggttgtgctgcaagatgaataa

DBGET integrated database retrieval system