KEGG   Setaria italica (foxtail millet): 101781159Help
Entry
101781159         CDS       T02818                                 

Definition
4-alpha-glucanotransferase DPE2-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101781159
Enzymes [BR:sita01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     101781159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 944 aa AA seqDB search
MASKKSLNTVTLLFKLPYYTQWGQSLLIAGSEPALGSWNVKQGLSLSPVHQNNELFWCGR
VSVAAGFTCEYKYYVVDDSKNVLRWESGEKRKLVLPEGVQDGDIIEIRDWWQDASDALFH
RSAFKNVIFNDTEGVKKELQSASLNKSLDPEDVVAQFIISCPRLVSGSTVIVTGSNPQLG
RWRAQDGLKMSYVGDSLWKANCVLRKSEFPVKYKYCQISQAGNPSLELGPNREVDIELSS
PKQSRYVVLSDGALRDAPWRGAGVAVPVFSIRSDEDLGVGEFLDLKLLVDWAVNSGFHLV
QLLPINDTSVHGMWWDSYPYSSLSVFALHPLYLRVQALSDAIPADVKEEIQQAKKHLDKK
DVDYEASLSTKLSIARKIFNLEKDKVLNSSSFKQFLSENEEWLKPYAAFCFLRDFFETSD
HSQWGRFSQFSKEKLEKLISEGTLHHDVIQFHYYVQYHLYMQLSEAAAYARKKKIILKGD
LPIGVDRNSVDTWVYPTLFRMNTATGAPPDYFDKNGQNWGFPTYNWEEMSKDNYGWWRAR
LTQMAKYFTAYRIDHILGFFRIWELPDHAATGLVGKFRPSIPLSQEELISEGLWDFDRMS
RPYIRQEILEEKFGSFWTVIAANFLNEYQKQCYEFKEDCNTEKKIIAKIKTSPEKSLWLE
KEDSIRRGLLDLLQNVVLIRDPEDPTKFYPRFNLEDTSSFSDLDEHSKNVLRRLYYDYYF
ARQENLWRQNALKTLPVLLNSSDMLACGEDLGLIPACVHPVMQELGLIGLRIQRMPSEPN
LEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDEGRRSRFYKTVVGSNEEPPSRCTPEVVH
FIVQQHFDAPSMWAIFPLQDLLALKDKYTTRPAPEETINDPTNPKHYWRFRVHVTLESLL
DDKDIQATIKDLVTGSGRSFPGKKVEGANESGEKLSKVQLNGKA
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaagaaatctctaaatacggtgactttgctgttcaaattaccatattacacg
caatgggggcagagccttctgattgctggctcggaaccagcactgggatcgtggaacgtc
aagcaaggactgtctctgagtccagttcatcagaataatgagctattctggtgtggaaga
gtctctgttgctgctggcttcacctgtgagtacaaatactatgtagtggatgacagcaag
aatgttttgagatgggagtctggggagaaaaggaaactagtcctgcccgagggtgttcaa
gatggagacataattgaaatacgtgactggtggcaggatgcttctgatgctctttttcat
agaagcgcattcaagaatgtcattttcaatgatactgaaggtgttaaaaaagaattgcag
tcagcgtccctcaacaaaagtttggatcctgaagatgttgttgcccagttcataattagc
tgtcctcgactcgtttctggctctactgtcattgtcactggaagtaatcctcagttagga
agatggcgagctcaagatggtctcaagatgagctatgttggagattccttgtggaaagcg
aactgtgttttgaggaagtctgagttccctgtaaaatacaaatactgtcaaatcagtcaa
gcaggaaacccttcattggagctaggtccaaacagggaggttgatattgaactatcatca
cccaagcaatccagatatgtcgtgttatctgatggtgcactcagggatgcaccatggagg
ggtgcaggtgttgccgtacccgtgttttcaatcagatcagatgaggacctaggtgttgga
gaatttctggatcttaaacttcttgtcgattgggcagtcaattcaggcttccatcttgtt
cagctccttccaatcaacgatacttcagttcatgggatgtggtgggattcttatccatac
agctcgctctctgtgtttgcgttgcatcccttgtacctgagagtacaagcactttcagat
gcaattccagcagatgttaaggaagaaattcagcaggcaaagaagcatttggataaaaag
gacgttgattacgaggcatcattgtccacaaaactgtcgattgctaggaaaatattcaat
ttagaaaaggacaaagtgctaaactccagttctttcaagcagttcttatctgaaaatgag
gaatggttgaaaccatatgcggcattttgctttttgcgggacttttttgagacatctgat
cacagccaatggggtcggttttctcagttttccaaggagaagcttgagaagcttatttcc
gaaggtactttgcaccacgacgttatacaatttcattactatgttcagtaccatctatat
atgcaattatcagaggcagctgcatatgcaagaaagaaaaagattatcctgaaaggtgat
ttacctatcggtgttgataggaatagtgtggatacttgggtatacccaactttgtttcgc
atgaatactgctaccggagcaccacctgattattttgacaagaatggacaaaattggggt
tttcctacatataactgggaggaaatgtcaaaggataattatgggtggtggcgagctcgt
ctgacacagatggcaaagtacttcacagcatacaggatagaccacatcttgggtttcttt
aggatatgggagcttccagatcatgctgcaacaggtttagttgggaaatttagaccttca
attcctcttagtcaggaggagcttataagtgaaggcctatgggattttgatcgaatgagc
cgaccatacattcgtcaggaaattctggaggagaagtttggatccttttggacagtcatc
gcagccaactttctaaatgagtatcagaagcagtgttatgagttcaaagaagattgcaac
acagagaaaaagattattgcgaagattaaaacaagtcctgaaaagtcactgtggctagag
aaagaagacagtatccgccgtggtcttttagatttacttcagaatgttgtccttatcaga
gatccagaggaccccacaaaattttatccccgtttcaacctggaagatacttcaagtttt
agtgatctagatgaacacagcaaaaatgtgctcagaagattgtactatgactattatttt
gctcgccaagaaaatctctggcgtcaaaatgcactgaagactctgcctgtcctgttgaac
tcatcagatatgttggcgtgtggagaagaccttggtctcatccctgcttgtgttcaccct
gttatgcaagaacttgggttgattggattgcgtatccaaagaatgcctagtgaaccaaac
ttggaatttggtattccttctcagtacagctacatgacggtttgtgctccctcatgtcat
gattgctctacattacgagcttggtgggaagaagatgaaggaagaagaagccgcttctac
aagactgtagttggcagcaatgaagaacccccatctcgctgcaccccggaagtagtgcac
ttcattgttcagcagcattttgatgctccatcaatgtgggcaatctttccacttcaggac
cttctcgccctgaaagacaagtacaccacaagaccagcaccagaggaaacaatcaatgac
cccactaatccaaagcactattggagattccgtgtccatgtgacgttagagtctctgttg
gacgacaaggacatccaagcaaccatcaaggaccttgtcacaggtagcgggagatccttc
cctggaaagaaggtggaaggtgccaacgaaagcggtgagaagttatctaaggtgcagttg
aacggtaaagcttag

DBGET integrated database retrieval system