KEGG   Setaria italica (foxtail millet): 101783018Help
Entry
101783018         CDS       T02818                                 

Definition
uncharacterized LOC101783018
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101783018
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101783018
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101783018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 382 aa AA seqDB search
MPDGVGAVQDAAAQFHEIVDKEAEVIEAEADVWSSWECEGVVEVGRATVGEDDDVGVAGS
PGSSSPLLQLVDVAAQDLEAWAVGGVSSGSRIDSRRERECWESQIKEWQRPILQDERLPE
CKSVFSIYFAPEWKKYSTVLSAPTADLLRGVGKASIGSWDWKLKEDKCTYHALFPRSWIG
FFSRILRRAAHLYIKKKKKYYNAGHPGTRTRFFGIRTLHWKTNTRSWTVYDGEPDPEVKI
ACHQISPFVPHNYEESSFPAAVFTFTVHNSGSAPADVTLLFTWANSVGGKSELTGNHRNS
KMKDRDGVSGVLLHHRAAGGHPPVTFAIASQETDGVGVSVCPSFTMGPSSSGGFTATRHV
GPDQEGGNIHPSLNSELRHLNL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatggtgtaggtgctgtccaagatgcggcggcccagttccacgagatcgtcgat
aaagaagcggaggtcatcgaagcagaggctgacgtgtggagtagctgggagtgcgagggc
gttgttgaggtaggccgcgccacggttggcgaagatgacgatgttggtgtggcaggttcc
cccggcagcagttcccccctccttcaactcgtggacgtagcggcacaggacctcgaggcg
tgggcggttggtggggtgagctccggaagcaggatcgacagcaggcgagagagagaatgt
tgggagtcccagatcaaggagtggcagaggccgatcctgcaagacgaaaggctgcctgaa
tgcaaatcagttttcagcatttatttcgcgcccgaatggaagaagtactccacggtgttg
tctgcgccgactgcggatctcctcaggggagtgggtaaagccagtattggatcttgggac
tggaagctgaaggaggacaaatgcacttaccacgccctgtttccaagatcatggataggt
tttttttcgagaatacttaggagagctgcccacctttatattaagaagaaaaagaaatat
tataacgcgggccatccgggcacacgcacacggttttttggcataagaacgctacattgg
aaaacgaatacaagatcatggacagtatatgatggtgagcctgaccctgaagtcaagatc
gcctgccatcagatatcgcccttcgtccctcacaattacgaagagagcagcttccctgct
gcggttttcacgtttacggtgcacaactctgggagcgcacctgcagatgtgacgctgctc
ttcacctgggctaattcagttggtgggaaatcagaactgaccgggaatcatcgcaactca
aaaatgaaagatcgggacggtgtcagtggcgttctcctgcatcacagggcggccggcggg
caccctccggtgacgttcgcgatcgcatcccaggaaacggacggcgtcggtgtcagcgtc
tgcccgtcgttcacgatgggcccgtccagctccggcggcttcacggcgacccgacatgtg
ggaccagatcaagaaggtggaaacatccatccatctctgaactctgaattacgtcatctg
aatctctga

DBGET integrated database retrieval system