KEGG   Setaria italica (foxtail millet): 101783371Help
Entry
101783371         CDS       T02818                                 

Definition
alpha-amylase type A isozyme-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101783371
Enzymes [BR:sita01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101783371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 436 aa AA seqDB search
MGMGSRHMCCLSTLLLLLGLSSGQVLFQGFNWESSKQTGGWYNNLMGKVDDIAAAGVTHV
WLPPPSHSVSSEGYMPGRLYDLDASKYGTAAELKSLIAAFHDKGVQAVADIVINHRCADY
KDSRGIYCIFEGGTPDSRLDWRAHMICRDDAKYSDGTGNLDTGADFPGAPDIDHLNDRVQ
RELTEWMLWLKSDLGFDAWRLDFARGYSAEVARVYINGTAPSFVVAEIWDKMVPAGDDGK
PAYDQDPHRQALVDWVDKVGGAASPATVFDFTTKGILNAAVEGELWRLIDTEGKAPGVIG
WWPAKAVTFVDNHDTGSTQAQWPFPHDKVMQGYAYILTHPGNPCIFYDHFFDWGFKDEIA
ALVAVRKRNGITPTSELTILEHDGDAYVAEIDGKVIVKIGSRYDLGHLIPVGFEVATHGK
DYAVWEKGGSEEVTRA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggggatggggagcaggcacatgtgctgcctgtcgaccctgctcctcctcctgggactg
tcatccggccaggtcctgttccaggggttcaactgggagtcgtcgaagcagacgggtggg
tggtacaacaacctgatggggaaggtcgacgacattgctgccgctggcgtcacgcacgtc
tggctcccgccgccgtcccactccgtctccagcgaaggttacatgcctggtcgtctatac
gacctggacgcgtccaagtacgggacggcggcggagctcaagtccctgatcgccgcgttc
cacgacaagggcgtgcaggcggtggcggacatcgtcatcaaccaccggtgcgccgactac
aaggacagccgcggcatctactgcatcttcgagggcggcacacccgacagccgcctcgac
tggcgcgcccacatgatctgccgcgacgacgccaagtactcggacggcacaggcaacctc
gacacgggcgccgacttccccggagcccccgacatcgaccacctcaacgaccgtgtccag
cgggagctcaccgagtggatgctatggctcaagtctgacctaggcttcgacgcatggcgc
ctcgacttcgccaggggctactctgcagaggtcgccagagtctacatcaatggcacggcc
ccgagcttcgtcgtcgccgagatatgggacaagatggtgcctgctggcgacgacgggaag
cccgcgtatgatcaggacccgcaccggcaggcactggtggattgggtggacaaggtgggc
ggagcggcgtcgccggccacggtgttcgacttcaccaccaaggggatcctgaacgccgcc
gtggagggtgagctgtggaggctcatcgatacggaggggaaggcgcccggcgtcatcggg
tggtggccggcgaaggccgtcaccttcgtcgacaaccacgacacgggctccacgcaggcc
caatggccgttcccccacgacaaggtcatgcagggctacgcctacatcctcacgcacccc
ggcaacccatgcattttctatgaccatttcttcgactgggggttcaaggacgagatcgca
gcactggttgcggtgcggaagcgcaatggcatcacgccgacgagcgagctgacgatcctc
gagcatgatggcgacgcctacgtggcggagatcgacggcaaggtgatcgtgaagatcggg
tccaggtacgacctcgggcaccttatcccggtagggtttgaggttgctacccacggcaag
gactacgccgtctgggagaaaggcggcagcgaagaagtgactcgggcatag

DBGET integrated database retrieval system