KEGG   Setaria italica (foxtail millet): 101783511Help
Entry
101783511         CDS       T02818                                 

Definition
thymidine kinase-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101783511
Enzymes [BR:sita01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101783511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 281 aa AA seqDB search
MRSICAMRSLLAAAAAASAPTVLRAGAFPLLPPLLSLPLRRGRAARNMLGAARTVSAAAQ
SRLGGGAAMDVRAAQSGEIHVIVGPMFAGKTTALLRRVQAEAGSGRTVVLIKSDKDNRYG
LDSVVTHDGTKMACWALSELSSFHDKLGMEAYDKVDVIGIDEAQFFDDLYDFCCKAADRD
GKIVVVAGLDGDYKRKKFGSVLDVVPLADSVTKLTARCELCGRRAFFTLRKTQETKTELI
GGADVYMPVCRHHYLDGQVVIEATRVVLGLDRSTVTAQALK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccatttgcgccatgagatccctcctcgccgctgccgctgccgcctccgccccc
acagtcctccgcgccggcgctttcccactgctgccgccgctcctctctctacctttacgc
cggggtcgtgccgccagaaatatgctgggcgcggcgaggacggtctctgcggcggcccag
tcacgactcggcggtggtgcggcgatggatgttcgggcggcccaatccggcgagatccac
gttatcgtcggccccatgttcgccggcaagaccaccgcgctcctccgccgggttcaggcc
gaggccggcagtggaaggactgtggtgctcataaagtctgacaaagataaccgctatgga
ttggattctgttgtcactcatgacggtacaaagatggcgtgctgggccttatcagagctg
tcaagtttccatgacaaattgggaatggaggcctatgataaggtagatgttataggtatt
gatgaagcccagttctttgacgatctttatgatttctgctgcaaagctgcagaccgtgat
ggaaaaattgtagttgttgcagggctagatggtgactacaaaaggaaaaagttcggctca
gttctggatgttgttcccctggctgactcggtcaccaagctaacagcacggtgtgagctg
tgtggtcgccgggcgttcttcacattgaggaagacacaggaaactaagaccgaactgatt
ggaggagctgatgtttatatgcccgtgtgtagacatcactacttggatgggcaggttgtt
attgaggccacaagggttgtactgggccttgaccgatccaccgtgacggctcaagctctg
aaatag

DBGET integrated database retrieval system