KEGG   Setaria italica (foxtail millet): 101784434Help
Entry
101784434         CDS       T02818                                 

Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101784434
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101784434
   00220 Arginine biosynthesis
    101784434
Enzymes [BR:sita01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101784434
Amino acid related enzymes [BR:sita01007]
 Aminotransferase (transaminase)
  Class I
   101784434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
IX
AA seq 482 aa AA seqDB search
MAASVAVENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFDEILYCNIGNPQSLG
QQPVTFFREVLALCDHPCLLEKEEIKSLFSADAISRAKQILATIPGRATGAYSHSQGIKG
LRDAIAAGIASRDGFPANADDIFITDGASPGVHLMMQLLIRNEKDGILCPIPQYPLYSAS
IALHGGTLVPYYLDEKTGWGLEISDLKKQLEDARSKGIDVRALVVINPGNPTGQVLAEDN
QCDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSLGYGEDDLPLVSFQSVSKG
YYGECGKRGGYMEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKVGDESFASY
KAEKDGILESLARRAKALEDAFNNLEGITCNKAEGAMYLFPQIHLPQKAIEAAKAAKKAP
DAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAVITRFKAFHEAFMAEY
RG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagcgtcgccgtggagaacctcaaccccaaggtcttaaaatgtgagtatgca
gtgcgtggggagattgtcattcatgctcagcgcttgcagcaacagctacaaaatcaacca
gggtctcttccttttgatgagatcctctactgcaacattgggaatcctcaatctcttggt
cagcaaccagtgacattcttcagggaggttcttgctctttgtgatcatccatgcttgttg
gagaaagaggaaatcaaatcactattcagtgctgatgctatttctcgagcaaagcagatt
ctggctactattcctggaagagcaacaggtgcttatagtcacagccagggtatcaaagga
cttcgtgatgcaattgctgctggtattgcctcacgtgatggattccctgcaaatgcagat
gacattttcattactgacggagcaagtcctggggtgcacttgatgatgcaattgctgata
aggaatgagaaagatggaattctgtgcccgattcctcagtaccccttgtactcagcatcc
attgctcttcatggtggaactcttgtcccctattaccttgatgaaaaaaccggatggggt
ttggagatctctgatcttaagaagcaacttgaagatgctcggtcaaaaggcattgatgtt
agggccttggtggttatcaatccaggaaacccaactgggcaggttcttgctgaggacaac
caatgtgacatagtgaaattctgcaaaaatgagggcctcgttcttctagctgatgaggta
tatcaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatagcaaga
tccttgggatatggcgaggatgatctccctttggtatcatttcagtctgtttctaaagga
tattatggagagtgtggtaaaagaggaggttacatggagattactggcttcagtgctcca
gtaagagagcagatctacaagatagcttcagtgaacttatgctccaatatcactggtcaa
atccttgccagcctcgtcatgaatccaccaaaggtcggggatgaatcgtttgcttcctac
aaggcagagaaagatggaatccttgaatctttagctcgtcgtgcaaaggcactggaggat
gcattcaacaatctcgagggaattacatgtaacaaggctgaaggagcaatgtaccttttc
cctcagattcatctgccacagaaggcaattgaggctgctaaagctgctaagaaagcacct
gatgcattctatgctctccgtctccttgaatcaactggaattgttgtggtccctggatcc
ggatttggccaagttcctggaacatggcatatcaggtgcacgatcctgccgcaggaagaa
aagatccccgcggtgatcacccgcttcaaggcgttccatgaggcgttcatggcggagtac
cgcggctaa

DBGET integrated database retrieval system