KEGG   Setaria italica (foxtail millet): 101784434Help
Entry
101784434         CDS       T02818                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101784434
   01210 2-Oxocarboxylic acid metabolism
    101784434
   01230 Biosynthesis of amino acids
    101784434
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101784434
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101784434
   00220 Arginine biosynthesis
    101784434
Enzymes [BR:sita01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101784434
Amino acid related enzymes [BR:sita01007]
 Aminotransferase (transaminase)
  Class I
   101784434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 482 aa AA seqDB search
MAASVAVENLNPKVLKCEYAVRGEIVIHAQRLQQQLQNQPGSLPFDEILYCNIGNPQSLG
QQPVTFFREVLALCDHPCLLEKEEIKSLFSADAISRAKQILATIPGRATGAYSHSQGIKG
LRDAIAAGIASRDGFPANADDIFITDGASPGVHLMMQLLIRNEKDGILCPIPQYPLYSAS
IALHGGTLVPYYLDEKTGWGLEISDLKKQLEDARSKGIDVRALVVINPGNPTGQVLAEDN
QCDIVKFCKNEGLVLLADEVYQENIYVDNKKFNSFKKIARSLGYGEDDLPLVSFQSVSKG
YYGECGKRGGYMEITGFSAPVREQIYKIASVNLCSNITGQILASLVMNPPKVGDESFASY
KAEKDGILESLARRAKALEDAFNNLEGITCNKAEGAMYLFPQIHLPQKAIEAAKAAKKAP
DAFYALRLLESTGIVVVPGSGFGQVPGTWHIRCTILPQEEKIPAVITRFKAFHEAFMAEY
RG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggccgccagcgtcgccgtggagaacctcaaccccaaggtcttaaaatgtgagtatgca
gtgcgtggggagattgtcattcatgctcagcgcttgcagcaacagctacaaaatcaacca
gggtctcttccttttgatgagatcctctactgcaacattgggaatcctcaatctcttggt
cagcaaccagtgacattcttcagggaggttcttgctctttgtgatcatccatgcttgttg
gagaaagaggaaatcaaatcactattcagtgctgatgctatttctcgagcaaagcagatt
ctggctactattcctggaagagcaacaggtgcttatagtcacagccagggtatcaaagga
cttcgtgatgcaattgctgctggtattgcctcacgtgatggattccctgcaaatgcagat
gacattttcattactgacggagcaagtcctggggtgcacttgatgatgcaattgctgata
aggaatgagaaagatggaattctgtgcccgattcctcagtaccccttgtactcagcatcc
attgctcttcatggtggaactcttgtcccctattaccttgatgaaaaaaccggatggggt
ttggagatctctgatcttaagaagcaacttgaagatgctcggtcaaaaggcattgatgtt
agggccttggtggttatcaatccaggaaacccaactgggcaggttcttgctgaggacaac
caatgtgacatagtgaaattctgcaaaaatgagggcctcgttcttctagctgatgaggta
tatcaagagaacatctatgttgacaacaagaaatttaactctttcaagaagatagcaaga
tccttgggatatggcgaggatgatctccctttggtatcatttcagtctgtttctaaagga
tattatggagagtgtggtaaaagaggaggttacatggagattactggcttcagtgctcca
gtaagagagcagatctacaagatagcttcagtgaacttatgctccaatatcactggtcaa
atccttgccagcctcgtcatgaatccaccaaaggtcggggatgaatcgtttgcttcctac
aaggcagagaaagatggaatccttgaatctttagctcgtcgtgcaaaggcactggaggat
gcattcaacaatctcgagggaattacatgtaacaaggctgaaggagcaatgtaccttttc
cctcagattcatctgccacagaaggcaattgaggctgctaaagctgctaagaaagcacct
gatgcattctatgctctccgtctccttgaatcaactggaattgttgtggtccctggatcc
ggatttggccaagttcctggaacatggcatatcaggtgcacgatcctgccgcaggaagaa
aagatccccgcggtgatcacccgcttcaaggcgttccatgaggcgttcatggcggagtac
cgcggctaa

DBGET integrated database retrieval system