KEGG   Setaria italica (foxtail millet): 101784841Help
Entry
101784841         CDS       T02818                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
sita  Setaria italica (foxtail millet)
Brite
Enzymes [BR:sita01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101784841
Transcription machinery [BR:sita03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101784841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 515 aa AA seqDB search
MDGLAAPSPSHSGATSGGGASHRKRKLPPSSLSDATADEDDDTTAPSSPSTAPSSPSHPS
SPSSSHSDDDDDDSLHTFTAARLDGAPGGGSASGRPPKPDSSSVSAAAAAAAAAAGTGPK
PEPGSAAASDGKEDPKGLFTDNLQTSGAYSAREEGLKREEDSGRLKFLCYSNDGVDEHMI
WLVGLKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYASQRFGEIAF
CAITADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKER
WQGYIKDYDGGILMECKIDQKLPYVDLATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKK
EAGIPRRLMKPEDIPGLREAGWTPDQWGHSKSRSAFSPDYNTYRQQLTSLMRILLKSMNE
HPDAWPFKEPVDSRDVPDYYDIIKDPIDLRTMSRRVESEQYYVTLEMFVADMKRMFNNAR
TYNSPDTIYYKCATRLENFFSGKIASQLAQASTKS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctcgcggcgccgtcgccgtcccactccggcgccacctccggcggcggtgcc
tcccaccggaagcggaagctcccgccgtcgtcgctctccgacgccaccgccgacgaggac
gatgacaccaccgcgccgtcgtccccctccacggcaccttcctcgccgtcccacccgtca
tccccatcctcctcccactctgacgacgacgacgatgactcgctccacacgttcactgcc
gcgcgcctcgacggcgcaccgggtgggggctccgcctccggccggcccccgaagccggat
tcctcgtcagtgtctgccgcagccgcagctgctgcagcggcagcgggaacggggcctaag
cctgagcctggctctgcggccgccagcgacggtaaggaggaccccaaggggctgttcact
gataacctccagaccagtggcgcgtacagcgcccgcgaggagggcctcaagcgtgaggaa
gactcgggaaggcttaaatttctctgctattctaatgacggtgttgatgaacacatgata
tggttggtaggtttgaaaaatatcttcgcccggcagcttcccaatatgcccaaagaatac
attgtgcgccttgtcatggatagaactcacaagtcaatgatggttatcaggaacaatatt
gtcgtgggaggtattacttatcgcccttatgcaagccagaggtttggagaaatagcattt
tgtgctattacagctgatgagcaagttaaaggatatggaacgaggttaatgaatcatttg
aagcaacatgcacgagatgctgatgggctcacacatttcttaacctatgcagataacaat
gctgttggttattttgtaaagcagggttttacaaaggagatcactttggacaaagaaaga
tggcaagggtacattaaagactatgacggaggaatattgatggagtgtaagattgaccaa
aagctgccatacgttgatctggctacaatgattcggcgtcaaaggcaggccattgatgag
aagatcagagagctttctaactgccatattgtttattcaggaattgattttcagaagaaa
gaagctggtattccaagaagactgatgaaaccagaagacatccctggtctgagggaagct
gggtggacacctgatcagtggggccattctaaatcacgttcagcattctccccggattat
aatacttatagacaacagcttactagccttatgcggatattgttgaagagtatgaatgaa
catcctgatgcatggccattcaaagagcctgtggattcacgtgatgttccagactattat
gacattatcaaagatcctattgatttgaggacaatgtcgagaagagttgagtctgagcag
tattatgtgaccttagagatgtttgtcgctgacatgaagagaatgttcaacaatgcacga
acatacaactctccggatactatctattacaaatgtgccacacgacttgagaatttcttc
tcaggcaaaattgcatcacagcttgcacaagcctcaaccaagagctag

DBGET integrated database retrieval system