KEGG   Setaria italica (foxtail millet): 101786218Help
Entry
101786218         CDS       T02818                                 

Definition
steroid 5-alpha-reductase DET2-like
Orthology
K09591  
steroid 5-alpha-reductase [EC:1.3.1.22]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Brassinosteroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00905 Brassinosteroid biosynthesis
    101786218
Enzymes [BR:sita01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101786218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 272 aa AA seqDB search
MADQAAAAAAGDAVFARCLLALYLISPLTVLALRYVSAPYGKLSRPGWGPALRAPLAWFL
MESPTLWLPPLVLLRSTPPSPPPLVALLSSPLAALPAVLYAFHYAHRTLVHPLRLARLRR
APAPVPLLVAACALGFNLLNAYVQARSITLHAGRLATPFALARCAAGLALFAWGMRTNIA
ADKELLRLKEAGGGYKIPRGGWFDLVTCPNYFGETVEWLGFAVVAWTPAAWAFFLYTCSN
LGPRARDHRRWYLQKFGSEYPASLKAFVPYIY
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccaggcggcggcggcggccgcgggcgacgcggttttcgcgcggtgcctgctg
gcgctctacctcatcagcccgctcaccgtgctggcgctccgctacgtctccgcgccgtac
ggcaagctctcgcgcccgggctggggccccgcgctccgggccccgctcgcgtggttcctg
atggagagccccaccctctggctcccgcccctcgtcctcctccgctccaccccgccttcc
ccgcccccgctggtggcgctgctctccagcccgctcgcggccctccccgccgtgctctac
gcgttccactacgcccaccgcacgctcgtccacccgctccgcctcgcccgcctgcgccgc
gccccggcccccgtgccgctcctcgtcgccgcctgcgccctcggcttcaacctcctcaac
gcctacgtgcaggcccgctccatcacgctccacgcgggccgcctggccaccccgttcgcc
ctggcccgctgcgccgccgggctggccctcttcgcgtgggggatgcggacgaacatcgcg
gccgacaaggagctgctgcggctcaaggaggccgggggcgggtacaagatcccgaggggc
gggtggttcgacctcgtcacctgccccaattacttcggcgagaccgtggagtggctgggc
ttcgccgtggtggcgtggacgcccgccgcgtgggccttcttcctctacacctgctccaac
ctcgggccgagggcaagggaccaccgccgctggtacttgcagaagttcggcagcgagtac
ccggcgtcgctcaaggcgttcgtcccctacatctattag

DBGET integrated database retrieval system