KEGG   Setaria italica (foxtail millet): W841_p054Help
Entry
W841_p054         CDS       T02818                                 

Gene name
rbcL
Definition
ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
Orthology
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
sita  Setaria italica (foxtail millet)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sita00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    W841_p054 (rbcL)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    W841_p054 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    W841_p054 (rbcL)
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     W841_p054 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
PT
AA seq 468 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEADQYICYIAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYAKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRACYECLRGGLDFTKDDENVNSQPFMRWRDRFVFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAAFARELGVPIVMHDYLTGGFTANTSLSYYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREITLGFVDLLRDDFIEKDRSR
GIFFTQDWASMPGVIPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAAAN
RVALEACVQARNEGRDLAREGNEIIKAACKWSPELAAACEVWKEIKFE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagaaactaaagcaagtgttggatttaaagctggtgttaaggattat
aaattgacttactacaccccggagtacgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcagcccggggttccgcctgaagaagcaggggctgcagtagctgcggaa
tcttctactggtacatggacaactgtttggactgatggacttaccagtcttgatcgttac
aaaggacgatgctatcacatcgagcccgttcctggggaggcagatcaatatatctgttat
atagcttatccattagacctatttgaagagggttctgttactaacatgtttacttccatt
gtgggtaacgtgtttggtttcaaagccctacgcgctctacgtttggaggatctacgaatt
cccactgcttatgcaaaaactttccaaggtccgcctcacggtatccaagttgaaagggat
aagttgaacaagtatggtcgtcctttattgggatgtactattaaaccaaaattgggatta
tccgcaaaaaattacggtagagcgtgttatgagtgtctacgcggtggacttgattttacc
aaagatgatgaaaacgtaaactcacaaccatttatgcgctggagagaccgttttgtcttt
tgtgctgaagcaatttataaagcacaagcagaaactggtgaaattaaggggcattacttg
aatgcgactgcaggtacatgcgaagaaatgattaagagagctgcatttgcaagggaatta
ggggttcctattgtaatgcatgactacttaactggaggattcaccgcaaatactagtttg
tcttattattgccgcgacaacggcctacttcttcacattcaccgagcaatgcatgcagtt
attgatagacagaaaaatcatggtatgcatttccgtgtattagctaaagcattgcgtatg
tcggggggagatcatatccactccggtacagtagtaggtaagttagaaggggaacgcgaa
ataactttaggttttgttgatttattgcgcgatgattttattgaaaaagatcgttctcgc
ggtatctttttcactcaggactgggcatccatgccaggtgttataccggtggcttcaggg
ggtattcatgtttggcatatgccagctctgaccgaaatctttggagacgattctgtatta
caatttggtggaggaactttaggacatccttggggaaatgcacctggtgcagcagctaat
cgtgtggctttagaagcctgtgtacaagcccgtaacgaagggcgcgatcttgctcgtgaa
ggtaatgaaattatcaaagcagcttgcaaatggagtcctgaactagccgcagcttgtgaa
gtatggaaggagatcaaatttgaatag

DBGET integrated database retrieval system