KEGG   Streptococcus intermedius C270: SII_0874Help
Entry
SII_0874          CDS       T02831                                 

Gene name
amy
Definition
cytoplasmic alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
siu  Streptococcus intermedius C270
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:siu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882415..883863
Genome map
AA seq 482 aa AA seqDB search
MENQTLMQYFEWYLPNDGQHWNRLAKDAPHLASKGIRKVWMPPAFKATSSNDVGYGIYDL
FDLGEFNQKGTVRTKYGLKEEYLKAIKSLKENGIEPIADVVLNHKAAADYKERFTVIEVD
PNDRTVALSEPFEIKGWTKFTFPGRHKKYNDFEWHWYHFTGTDYDAQQNKSGIYLIQGDN
KGWADDDLVDNENGNFDYLMYADLDFKHPEVIQNLYDWADWFIKTTGIHGFRLDAIKHID
SFFMGNFIRDISAKYGDDFYVFGEFWNSDETANNDYLGSIDYRFDLVDVKLHHNLFDASR
AGSGYDLRNIFEQTLVKNHPESAVTFVDNHDTQRGQALESTIEEWFKPAAYALILLREAG
LPCVFYGDYYGVNGEFAQDSFQTVLDKLLDIRLNLAYGEQKDYFDDEHCIAWTRSGKDNG
QPIAVILTNDQANSKRMYVGENWAGKEFKDYLGNNPSTVIIEEDGWANFPVVEKSVSVWS
AK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaacattaatgcaatattttgaatggtatctaccaaatgatggacaacat
tggaatcgcttagcaaaagacgccccacatctagcttctaaaggaattcgaaaggtttgg
atgccgcctgctttcaaagcaactagctccaatgatgtcggctacggtatttatgatcta
ttcgacttaggagaatttaaccaaaaaggcaccgttcggacgaagtacggcttaaaagaa
gaatatttgaaagctattaagtcgctcaaagaaaatgggatcgagcctattgcagatgtc
gttttaaatcacaaggcagcagcggattacaaagagcgatttactgttattgaagttgat
ccaaacgatcgtacagttgcactctctgaacctttcgaaattaaaggttggactaaattc
acgttcccaggtcgccacaaaaaatataatgatttcgagtggcattggtatcactttact
gggactgattatgatgctcaacagaataaatcagggatttatctcattcaaggagacaac
aaagggtgggcagatgatgacttagttgataatgaaaatggcaattttgattatctcatg
tatgctgaccttgactttaaacatccagaagtaattcaaaacctttatgattgggcagat
tggttcatcaaaacaacaggcattcatggcttccgactagacgcaattaaacatatcgac
tctttctttatgggaaattttatccgcgacatctcagctaaatacggagacgatttctat
gtctttggagagttttggaatagtgatgaaacagcaaacaacgattatttaggaagtatt
gactatcgttttgatttagtagatgtcaaactacatcataatttgtttgatgctagccgt
gctggatctggctatgatttaagaaatatttttgaacaaactctcgttaaaaatcaccct
gaatctgcggttacttttgttgataaccatgatacacaacgcggtcaagcgctggaatca
actattgaagagtggtttaaacctgctgcttatgctcttattttattacgcgaagcaggc
cttccttgcgttttctacggagactactatggcgtcaatggggaatttgctcaagacagc
ttccagacagttcttgataaattattagatatccgtctcaatctagcttatggtgaacag
aaagattattttgacgacgagcattgtattgcttggactcgttcaggcaaagacaatgga
cagccaattgccgttattttgacaaatgatcaagcaaattcaaaacgcatgtatgtcggt
gaaaactgggctggcaaagaattcaaagactacttaggaaacaacccttcaactgtgata
attgaggaagacggctgggcaaatttcccagttgtagaaaaatcagttagtgtctggtct
gcgaaataa

DBGET integrated database retrieval system