KEGG   Streptococcus intermedius C270: SII_1785Help
Entry
SII_1785          CDS       T02831                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
siu  Streptococcus intermedius C270
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SII_1785 (malQ)
Enzymes [BR:siu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SII_1785 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1864345..1865856)
Genome map
AA seq 503 aa AA seqDB search
MKERQSGVLMHISSLPGKYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDRLVEEGLLVQSDLEGLDFGQDPRKVDYAKVFNNRRPVLEKAVKRFL
EVDDLAAYEKFVADNSSWLEVFVEYMAIKEYFDLKAWTEWPDAALRHREAASLAHYREKL
ADRLTYHRVTQYLFFKQWLELKAYANEHYIEIVGDMPIYVAADSCDVWAQPHFFKTDELG
QPTCVAGCPPDEFSATGQLWGNPIYDWEAMDKDGYSWWIKRLRESFKIYDVVRIDHFRGF
ESYWEIPAGSDTAAPGKWVKGPDYALFKAVKEELGELNIIAEDLGFMTDEVIALREKTGF
PGMKVIQFAFNPESESIDSPHLAPNNSVMYTGTHDNNTVLGWYRDEIDDATREYMAQYTN
RKEYETVPHAMLRTIFSSVSFMAIATMQDLLELDGSARMNYPSTIGGNWSWRMTADDLDP
VIEAELYSLTKTYRRLNKNLLKK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgtcaaagtggtgttctcatgcatatttcttctctaccaggaaaatacgga
atcggttcatttgggcaaagtgcttacgattttgtcgattttctggtgagaactaagcaa
cgttactggcaaatattgccgctaggaacaactagttatggagattctccatatcaatct
ttttctgcatttgcgggaaatacacattttattgattttgatcgattggttgaagaagga
ttgcttgtgcaaagtgatcttgaagggctagactttggtcaagatcccagaaaagtagat
tacgcaaaggtatttaataatcgtaggcctgtgttggaaaaggcggtgaaacgtttctta
gaagttgatgatttggcagcttatgaaaagtttgtggctgacaactcatcatggctcgaa
gtatttgttgaatacatggcgattaaagagtattttgacttgaaagcttggactgaatgg
ccagatgcggctcttcgacatcgtgaagcagctagtttagcccattatcgtgaaaaatta
gctgacagattgacttatcatcgtgtaacgcagtatcttttctttaaacaatggttagaa
ttaaaagcgtatgccaatgaacattacattgaaattgttggcgatatgccaatctatgta
gcagctgatagctgtgatgtttgggcacaaccacacttctttaaaacagatgagctaggg
caacctacatgcgtagcgggatgcccaccagatgaattctctgcgactggccaactctgg
gggaacccaatttatgactgggaagcaatggataaagatggttatagttggtggattaaa
cgcctacgtgaaagcttcaagatttatgatgtagtacgtattgatcatttccgtggattt
gagtcttactgggaaatccctgcgggttctgacacagcagctccaggtaaatgggtaaaa
ggtcctgattatgctttgtttaaagctgtaaaggaagaattgggtgaactaaatattatc
gctgaggatttgggctttatgaccgacgaagtgattgctctgcgtgaaaaaacgggcttc
cctggcatgaaagtcattcaatttgcttttaatccagagtctgaaagtattgatagtcca
catcttgcgcctaataattctgtgatgtacacagggacacatgataacaatactgttctt
ggttggtatcgtgatgaaatcgatgatgctacacgtgaatatatggctcaatataccaat
cgtaaggaatatgaaacagtacctcatgcaatgttacggactattttttcttctgtcagc
tttatggcaattgcaaccatgcaagatttacttgaattagacggttcagctcgcatgaac
tatccatcaactattggtggaaattggtcctggcgtatgacagcagatgatttggatcct
gtgattgaagcagagttatatagcttgacgaaaacatatcgtcgtttaaataaaaattta
ttaaagaaatag

DBGET integrated database retrieval system