KEGG   Solibacillus silvestris: SSIL_0004Help
Entry
SSIL_0004         CDS       T02162                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
siv  Solibacillus silvestris
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:siv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(14616..15140)
Genome map
AA seq 174 aa AA seqDB search
MMTTAYLSIGTNIGEREQNLQDAVKLLTAHEAISVTAISSIYETAAVGYTDQADFLNIAL
ALETELDAFELLAECQKIENDLGRVREFRWGPRIIDLDILLYGQQLYETEKLIIPHPRMY
ERAFVLVPLEEIMTQNYDMLVGVQKALHALDIEKEGVNLWKKINTVAEFVPFEN
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgacagcgtacttatcgatcggtacaaatataggtgagcgtgagcaaaacttg
caagacgcggtaaagctgctcaccgcacatgaggcgatatctgtaacagcgatttcttca
atttatgaaacagcagcagtaggctatacagatcaggcagattttttgaatatcgcgctt
gctcttgaaacggaactcgatgcctttgagcttcttgcggagtgccaaaaaatcgaaaat
gatcttggccgtgtccgtgaatttcggtggggaccacgaataatagatttggatattttg
ctgtatggtcaacaactgtatgaaaccgaaaaattaataattccacatcctcgaatgtac
gaacgtgcatttgtgcttgtaccgttagaagagattatgacgcaaaattatgatatgctt
gtaggcgtgcaaaaagcgttacatgcacttgatatagagaaagaaggcgtcaatctgtgg
aagaaaatcaatacggtcgcagaattcgtgcctttcgaaaactaa

DBGET integrated database retrieval system