KEGG   Solibacillus silvestris: SSIL_0006Help
Entry
SSIL_0006         CDS       T02162                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
siv  Solibacillus silvestris
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:siv00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(15516..16376)
Genome map
AA seq 286 aa AA seqDB search
MLENYKVLTLNGIELDFRKETFVMGILNVTPDSFSDGGRFNSVEKAVAQAKKMVADGAKI
IDVGGESTRPGYTRISDEEEIARVVPVIRALLKEVPAIISIDTYKSNVARAAIEAGAHII
NDIWGAKADPEMASVAAELDVPIILMHNRLSDQYDNYFNDYMADMQESIAIVKAAGVRDE
HIFLDPGIGFVKSLSESIETMQRLDELVALGYPVLLATSRKRMIGSILELPVDDRVEGTA
ATCAFGVQKGCHMMRVHDVKEVARTVKMMDALVGKFEVQGELAPRH
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaactataaagtactcacattaaatgggatcgaactggattttcgtaaagaa
acattcgtgatgggcattttaaatgtaacaccggactcattttcggatggcggcaggttc
aattcggttgaaaaagcagttgcacaggcgaaaaaaatggtggcagatggcgcaaaaatt
atcgatgttggcggggaatcaacacgccctggctatacacggatttcagatgaggaagaa
attgcacgtgttgtaccggtaattcgggcgcttttgaaagaagtacctgcgattatttca
attgatacgtataaatcgaatgttgcgcgtgctgcaattgaagcaggggcacatattatt
aatgatatatggggcgcaaaggcggatccggaaatggcaagtgtcgcggcagaactcgat
gtgccgattattttaatgcataaccgcctgtcagatcagtacgataactactttaacgat
tatatggccgatatgcaggaaagtattgcgattgtaaaagcagcaggtgtacgtgacgag
catattttccttgatcctggtatcggttttgtgaaaagtttaagtgaaagtattgaaacg
atgcagcgccttgatgagcttgttgcattaggctatccagtattgcttgcgacatcacgc
aagcgtatgatcggatcgattttggaactacccgtagatgaccgagtggaagggacagcc
gctacttgtgcatttggtgtccaaaagggctgccatatgatgcgtgttcatgatgtaaag
gaagtggcgcgtacagtgaagatgatggatgcgcttgtagggaaatttgaagtacaaggt
gaattggcaccgagacattaa

DBGET integrated database retrieval system