KEGG   Solibacillus silvestris: SSIL_0060Help
Entry
SSIL_0060         CDS       T02162                                 

Definition
recombinational DNA repair protein
Orthology
K06187  
recombination protein RecR
Organism
siv  Solibacillus silvestris
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:siv03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(79031..79627)
Genome map
AA seq 198 aa AA seqDB search
MHYPEPISRLIDSFMKLPGIGPKTAARLAFHVLTMKEDTVSTFAKALVDAKRNLMYCSQC
GHITDIDPCHICSDKQRDVSTICVVQDPKDVIAMEKMRDYQGLYHVLHGAISPMDGVGPE
DINVASLLGRLHDERVQELILATNPTIEGEATAMYISRLVKPSGIRTTRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatccagagccgatatctcgattaatagacagctttatgaaactgccgggcatt
ggtccgaaaacagcagctcgactggcatttcacgtactaacaatgaaggaagatactgta
tcgacatttgcgaaagcgcttgtcgatgcaaaacgtaatttaatgtattgctcacaatgt
ggtcatataacagatatcgacccttgccatatttgttcggataaacaacgtgatgtttca
acaatttgtgttgtgcaggatccgaaagatgtaatagctatggagaagatgcgtgactat
caaggtctctatcatgtgttacacggtgcaatttcacctatggacggtgtaggacctgaa
gatattaatgtagcttcgctattggggcgcttacatgacgagcgtgtacaagagttaatt
ttagcgacgaacccgacaatagaaggggaagcaacggcaatgtatatttcccgccttgtt
aaaccatccggaattcgaactacacgtatcgcacacggattacctgttggcggagattta
gaatatgcggatgaagtaaccttatcaaaagcgctggaaggtagacgcgagttgtaa

DBGET integrated database retrieval system