KEGG   Solibacillus silvestris: SSIL_0077Help
Entry
SSIL_0077         CDS       T02162                                 

Definition
deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
siv  Solibacillus silvestris
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SSIL_0077
   00240 Pyrimidine metabolism
    SSIL_0077
Enzymes [BR:siv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     SSIL_0077
    2.7.1.76  2'-deoxyadenosine kinase
     SSIL_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97366..98034)
Genome map
AA seq 222 aa AA seqDB search
MNLREKYNIPANAVITIAGTVGVGKSTMTKALSQSLNFRTSYEKVDTNPYLDKFYDDFEK
WSFHLQVYFLAERFKEQKRIFEYGGGFIQDRSIYEDTGIFAKMHYDKGTMTPTDYETYTN
LFDAMVMTPYFPHPDLLVYLEGPIDDVIGRIHERGREMEQQTPHSYWEEMHGRYEDWINN
FNACPVLRIDINDYDLMKNPAQVEDVVARIGYMLEQTSHLRK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaagagagaagtacaatattcctgcgaatgcagtgattacaatagcaggaaca
gtcggtgtcggaaagtcaacaatgactaaagcattatcacagagcttaaatttccgtaca
tcttatgaaaaggttgatacaaacccttatttagataaattctatgacgattttgaaaag
tggagcttccatttgcaagtttatttccttgctgaacgttttaaagaacagaagcgtatt
tttgaatatggcggaggctttatacaagaccgttctatttacgaagatacaggtattttt
gcaaagatgcattatgacaaagggacaatgacaccgacagactatgaaacatatacaaat
ttgtttgatgcgatggtgatgacaccgtatttcccgcacccggatttgcttgtatatttg
gaaggtccgattgatgatgtgattggtcgtatccacgaacgtggacgcgagatggagcag
caaacacctcattcgtactgggaagaaatgcacggacgttatgaagactggattaacaat
ttcaatgcatgtccagtattgcgtattgatattaacgattacgatctaatgaaaaatcct
gcacaagttgaggatgtcgttgcacgtatcggatatatgcttgaacaaacaagccattta
cgaaaataa

DBGET integrated database retrieval system