KEGG   Solibacillus silvestris: SSIL_0126Help
Entry
SSIL_0126         CDS       T02162                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
siv  Solibacillus silvestris
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SSIL_0126
Enzymes [BR:siv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SSIL_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(155425..156303)
Genome map
AA seq 292 aa AA seqDB search
MITVIGSINMDLVVQMDVFPKKGETVLGSLFTTVPGGKGANQAVAAARLGSKVKMLGAVG
SDSFGTELRANLNEENIDTSLVMNTSGATGIANILLHESDNRIVVVPGANSKVSPEVIAS
AKTVIENSQLVVMQLEIPVETIKYSLNLCKELQVPVLFNPAPAANFDIEWMPYIKYLTPN
ETECALLFGDDVEAALEKYPNQLIVTLGEDGARYFDGTKHVHVKGFNTTAVDTTGAGDTF
NGAFAHAITNGQSIEEAVFFANIAASLSVEKFGAQGGMPKLEDVIVRKEGAK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgataacggtaattggaagtatcaatatggacttagtcgttcaaatggatgtattccct
aaaaaaggggaaaccgttttagggagcttatttacaacggttccaggcggaaaaggtgcg
aatcaggcagtagcagctgcacgtttaggcagcaaagtaaaaatgttaggcgctgtcggc
tcggatagcttcggtacggaactccgtgcgaacctgaatgaagaaaatatagatacgagc
ttagttatgaatacaagtggtgctacaggcattgcaaatattttactccacgaatcggac
aaccgtattgtcgttgtaccaggcgccaactctaaagtatctccagaagtgatcgcttct
gcaaaaactgttattgaaaatagtcagttagttgtaatgcagcttgaaattccagtagaa
acgataaagtatagcctgaatttatgtaaagagcttcaagtaccagtactatttaatcct
gctccagcagcaaacttcgacattgaatggatgccgtatattaagtacttaacaccgaac
gaaactgaatgtgccctactatttggagatgatgttgaagcagcattggaaaaatatcca
aatcagttaattgtgacattaggtgaagatggtgcacgctactttgatgggacaaaacat
gtacatgtaaaagggttcaacacaacagctgtcgatacgacaggtgccggtgatacattt
aacggtgcctttgcacatgctattacaaacggtcaatcgattgaagaagcagtatttttt
gcgaatatagcagcgtcattgtccgttgaaaaatttggagcccaaggtgggatgccaaaa
ttagaagatgtaattgttcgaaaggaaggcgcaaaatga

DBGET integrated database retrieval system