KEGG   Solibacillus silvestris: SSIL_0211Help
Entry
SSIL_0211         CDS       T02162                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
siv  Solibacillus silvestris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_0211
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SSIL_0211
   00630 Glyoxylate and dicarboxylate metabolism
    SSIL_0211
Enzymes [BR:siv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SSIL_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251112..253289
Genome map
AA seq 725 aa AA seqDB search
MTNYVQVGNLQVTEVLFQFINEQVLPNSGVEQTAFWDGFDKLVHELAPENKALLAQRDAL
QVQINEWHKGNKGNFQFADYKAFLEEIGYVEPKAEDFQVETENVDAEIAYQAGPQLVVPV
SNARYAINAANARWGSFYDALYGTDVISDEDGTEAGKGYNPIRGNKVIDYAKKFLDQAAP
LKAASHKDAITYKIAESKLVITLVNGETTTLAEPEKLVGYQGTTEQPTAILLKNNDLHIE
IQIDRNHPIGKDDAAGVKDIYLESAITTIMDCEDSVAAVDAEDKVEVYANWLGLMKGDLT
ATFAKGSKTVTRTLNPDRVYTGVNGDTVTLNGRSLMFIRNVGHLMTNPAILDQDGSEVPE
GIMDGVVTSLIAKHEVIGNGSYKNSQKGSIYIVKPKMHGSKEVAFANKLFERVEDLIGLE
RFTLKIGVMDEERRTSLNLKACIREVKNRIVFINTGFLDRTGDEIHTSMEAGPMIRKGEM
KTSTWLTSYEKSNVIVGLNAGLQGRAQIGKGMWAMPDLMAEMIEQKINHPKAGANTAWVP
SPTAATLHATHYHEVNVKDVQKGIVSSEDLQDAILEIPVAANTDWTREEIQHELDNNAQG
ILGYVVRWVEHGVGCSKVPDINNIGLMEDRATLRISSQHVANWLHHGICTKEQVEESLKR
MAKIVDEQNADDPEYLPMSANYEDSVAFQAASELIFKGYDQPNGYTEPILHKKRIEAKAK
QKVNA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaattatgtgcaagtggggaacttacaagtaacggaagtattatttcagtttatt
aatgagcaagtattaccaaacagtggagtagagcaaacggcattttgggatggcttcgat
aagctggttcatgagttggcacctgaaaataaagcattgcttgctcaacgtgatgcattg
caagtacaaattaatgagtggcataaaggaaataaggggaatttccaatttgccgactat
aaggcgtttttagaagaaatcggttatgtagaaccaaaagcagaagacttccaagtggaa
acagaaaacgtagatgcagaaattgcatatcaggcaggtccgcaattagtagtacctgtc
agcaatgcacgctatgcaattaatgcagcaaatgcacgttggggaagtttctatgatgca
ctatacggtacagatgtcattagtgacgaagacggtactgaagcaggcaagggttataat
ccgattcgtggaaacaaagtaatcgattatgcgaaaaagtttttagatcaagcagctcct
ttaaaagcagcttcacataaagatgcaataacttataaaattgcagaaagtaaattagta
attacgctcgtaaatggtgaaacgacgacattggcagagccggaaaagttagtaggctac
caaggaacaacagaacagccgactgcgattttactgaaaaataatgatttgcacattgaa
attcaaattgaccgaaatcacccaattggaaaagatgatgcagctggagtaaaagatatt
tatttagagtctgctattacgacaattatggactgcgaggactcggtagcagcagtagat
gcagaagataaagtggaagtttatgcaaactggttagggctaatgaaaggcgacttaacg
gcaacttttgcaaaaggatcgaaaacggtaacacgtacattaaatcctgaccgagtatat
acgggagttaatggtgatacggtaacattaaatggccgctctttaatgtttattcgcaat
gtaggtcacttaatgacaaatccggcaattctagatcaagatggcagcgaagtgcctgaa
ggaattatggatggtgtcgtaacgagcttaatagcgaagcatgaagtaattggcaatggt
tcgtataaaaattcgcaaaaaggctctatctatattgtaaaaccaaaaatgcacggctca
aaggaagtagcgtttgcaaataaactatttgagcgtgtagaagatttaatcggattggaa
cgattcacgttaaagattggtgttatggatgaggaacgacgtacatcacttaacttaaaa
gcatgtatacgtgaagtgaagaatcgtattgtctttattaatacaggattcctggatcgt
acaggagatgaaatccatacatcaatggaagcgggcccaatgattcgcaaaggcgaaatg
aaaacatcaacatggctcacatcttatgaaaaatccaatgtcatcgttgggttaaatgca
ggcttgcaaggccgtgcacaaattggaaaagggatgtgggctatgccggacttaatggca
gagatgattgagcagaaaatcaatcatccaaaagcaggggcaaatactgcttgggtacca
tcgccgacagccgcaacattacatgcaacacattatcatgaagtaaatgtaaaagacgtt
caaaaaggtattgtgtcatcggaagatttacaagatgcgattttggaaatcccggtagcg
gcaaatacagattggacacgtgaagaaattcaacatgagcttgataataatgcacaagga
atccttggctacgtagtccgttgggtggaacatggtgtgggctgttcaaaagtgccggat
attaataatatcggcttaatggaagaccgcgcaacgttgcgtatttcaagtcagcatgtt
gcaaactggctgcatcacggtatttgtacgaaagaacaagtagaggaatcattgaaacgt
atggcaaaaattgtagatgagcaaaatgcagacgatcccgaatatttaccaatgtcagca
aactacgaggattctgtagctttccaagcagcaagtgagcttatatttaaaggctatgat
caaccaaatggttacacagagccgattttacacaaaaagcgtattgaagcgaaagcaaaa
caaaaagtaaacgcataa

DBGET integrated database retrieval system