KEGG   Solibacillus silvestris: SSIL_0265Help
Entry
SSIL_0265         CDS       T02162                                 

Definition
arginase/agmatinase/formimionoglutamate hydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
siv  Solibacillus silvestris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SSIL_0265
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SSIL_0265
Enzymes [BR:siv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SSIL_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
298511..299416
Genome map
AA seq 301 aa AA seqDB search
MMNKKISIVGVPCDYGQQRRGVDMGPSAIRYAGLQQRLTNLGYEVEDEGNIQVIEGDAAA
QKDEKLLNLEEVIKVNTALAEKVFNVVKKDYIPLVLGGDHSIAIGTLAGLSMKYKNQGVI
WFDAHADLNTPETTPSGNIHGMPLATSIGLGHQRLTSILHAEPKIKAENIVIIGGRSIDE
GERELIKTRGIKIYTMHEIDRLGMTYVMEETLKYFKQLQIDGLHLSLDLDALDPLYTPGV
GTPVAGGITYRESHLAMEMIQESGLMTSAEFVEVNPILDERNKTADVAVALIGSLFGETL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataagaaaatttcaatcgtaggggtaccatgtgattatgggcaacagcgccgt
ggggtggatatgggaccgagtgcaattaggtatgcggggttgcagcaacgtttgactaat
cttggatatgaagttgaggatgaagggaatattcaagtaattgaaggggatgcagctgca
cagaaagatgaaaagctgcttaatctggaagaagtaattaaggtcaatacagcgcttgcc
gaaaaagtatttaacgtcgtaaaaaaggattacataccgcttgttttaggaggcgaccat
agtattgcaattggtacattggctggcctatcgatgaaatataagaatcagggcgtgatc
tggtttgatgctcatgcagatttaaatacaccggaaacgacaccatcgggaaatattcat
ggaatgccgctagcaacaagtattgggctaggacatcaaaggctaacgtcaattttacat
gcagaaccaaaaattaaagccgaaaacattgttataattggggggcgttctatcgatgag
ggtgaacgggaacttattaagacacgaggcattaaaatatacacaatgcacgaaattgat
cggcttggaatgacgtatgtaatggaagaaacactaaaatactttaagcaattgcaaata
gacggccttcatttatcacttgatttagatgcattagatcctttatatactcctggagtg
gggacaccggtagcaggtgggatcacttacagagaaagtcatttagcgatggaaatgata
caggaatccggattaatgacatcagcagagtttgtagaagtgaaccctatattagatgag
agaaataaaacagcagatgtagcggttgcattaattggctctttatttggcgaaacttta
gtatga

DBGET integrated database retrieval system