KEGG   Solibacillus silvestris StLB046: SSIL_0265Help
Entry
SSIL_0265         CDS       T02162                                 

Definition
(GenBank) arginase/agmatinase/formimionoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00220  Arginine biosynthesis
siv00330  Arginine and proline metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01130  Biosynthesis of antibiotics
siv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SSIL_0265
   00330 Arginine and proline metabolism
    SSIL_0265
Enzymes [BR:siv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SSIL_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAK14688
UniProt: F2F4F4
Position
298511..299416
Genome map
AA seq 301 aa AA seqDB search
MMNKKISIVGVPCDYGQQRRGVDMGPSAIRYAGLQQRLTNLGYEVEDEGNIQVIEGDAAA
QKDEKLLNLEEVIKVNTALAEKVFNVVKKDYIPLVLGGDHSIAIGTLAGLSMKYKNQGVI
WFDAHADLNTPETTPSGNIHGMPLATSIGLGHQRLTSILHAEPKIKAENIVIIGGRSIDE
GERELIKTRGIKIYTMHEIDRLGMTYVMEETLKYFKQLQIDGLHLSLDLDALDPLYTPGV
GTPVAGGITYRESHLAMEMIQESGLMTSAEFVEVNPILDERNKTADVAVALIGSLFGETL
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataagaaaatttcaatcgtaggggtaccatgtgattatgggcaacagcgccgt
ggggtggatatgggaccgagtgcaattaggtatgcggggttgcagcaacgtttgactaat
cttggatatgaagttgaggatgaagggaatattcaagtaattgaaggggatgcagctgca
cagaaagatgaaaagctgcttaatctggaagaagtaattaaggtcaatacagcgcttgcc
gaaaaagtatttaacgtcgtaaaaaaggattacataccgcttgttttaggaggcgaccat
agtattgcaattggtacattggctggcctatcgatgaaatataagaatcagggcgtgatc
tggtttgatgctcatgcagatttaaatacaccggaaacgacaccatcgggaaatattcat
ggaatgccgctagcaacaagtattgggctaggacatcaaaggctaacgtcaattttacat
gcagaaccaaaaattaaagccgaaaacattgttataattggggggcgttctatcgatgag
ggtgaacgggaacttattaagacacgaggcattaaaatatacacaatgcacgaaattgat
cggcttggaatgacgtatgtaatggaagaaacactaaaatactttaagcaattgcaaata
gacggccttcatttatcacttgatttagatgcattagatcctttatatactcctggagtg
gggacaccggtagcaggtgggatcacttacagagaaagtcatttagcgatggaaatgata
caggaatccggattaatgacatcagcagagtttgtagaagtgaaccctatattagatgag
agaaataaaacagcagatgtagcggttgcattaattggctctttatttggcgaaacttta
gtatga

DBGET integrated database retrieval system