KEGG   Solibacillus silvestris: SSIL_0445Help
Entry
SSIL_0445         CDS       T02162                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
siv  Solibacillus silvestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:siv00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488354..489739
Genome map
AA seq 461 aa AA seqDB search
MKTVVVVGGGITGLCTMHYLKNKMHEQNVEARLILIEKNAYLGGKIHSEYDKGFIMETGA
DSIVARHPGVLELVKELNFESELVYNETGISYIHTNNELHAIPAGSTFGIPMSVESLMSS
TLISQEGKKRALQDLEIPNTKFTKESSIGTFLEYFLGEEIVRKQIAPVLAGVYSGDLYQL
SLASTLPYLVDYKNNYGSIIKGFEAHREQFEKAANKKFISFRPGLSALINRLEEQLPEVE
FMRKTVTKQILKKGEQYEVVLEDETILADIVVLAVPNETVRHVIQDNSLEEQLKKFTTAS
TLTMYVGFDVPDDILPADGTGFIVSHNSDLICNASTWTSRKWKHTSAEGNLLVRLFYKDI
NPRYEELAAMSDEELTKVALEDIRLSLGVEADPTVINVTKWIDQMPRYDLAHNEALSKVI
QQLATDYPNVLLAGCAYFGVGIGACIQNGKKTAEHIISRIM
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtagtagttgtaggtggagggattaccgggctatgtacgatgcattatctg
aaaaataaaatgcatgagcaaaacgtggaagcgcggttaatactgattgaaaagaacgca
tatttaggcggaaaaattcattccgaatacgataaaggatttattatggaaacaggggct
gattcaattgtagcacgccatccaggggtattggagcttgttaaggagcttaattttgaa
tcagagcttgtctataacgaaacaggtatttcctacattcatacgaataacgagctgcat
gctattccggcaggttcgacattcggtattccaatgagtgtagaatcgctcatgtcgagt
acgttaatttcacaagaaggaaagaagagggcccttcaagatttagaaatcccgaatact
aaatttactaaagaaagctctatcggtacgtttttagaatattttttaggggaagaaatt
gttcgaaagcaaattgccccagtattggcaggagtttattcaggcgatttatatcaatta
agcctggcatctacattgccgtatttagtggattataaaaacaactatggatcgattatt
aaaggcttcgaggcacatcgcgagcaattcgaaaaagctgcgaataagaagtttatttct
ttccgtccgggtttatcagcattaatcaatcgtttagaagaacagctgccggaagttgaa
ttcatgagaaagacagtaacaaagcaaattctaaaaaaaggtgagcaatatgaagtcgtg
ctggaagatgaaacaatattggcagatattgttgtactggccgttccaaatgagacggta
cgtcatgtaatacaggataattcattagaggaacagctgaaaaagttcacgacggcatct
actttaacgatgtatgttggctttgatgtaccggacgatatattaccggctgatggtacc
ggctttatcgtttcgcataatagtgatttaatctgtaatgcatcgacatggacgagccgt
aaatggaagcatacgtcagcagaaggcaatttactcgttcgcttgttttataaagatatt
aatccgcgctatgaagagttggcagccatgtcagatgaagaactgacaaaagttgcattg
gaagacattcgtctcagcttaggtgttgaagcggatccaactgtcattaatgtaacaaag
tggattgaccaaatgccgcgctatgatttggcgcataatgaagccttatcaaaagttata
cagcaactggcaacggattacccgaatgttctattagcaggatgtgcctatttcggagta
ggaatcggtgcttgtattcaaaacggcaaaaaaacagctgaacacattattagtcgaatt
atgtaa

DBGET integrated database retrieval system