KEGG   Solibacillus silvestris: SSIL_0714Help
Entry
SSIL_0714         CDS       T02162                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
siv  Solibacillus silvestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SSIL_0714
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SSIL_0714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
783619..785046
Genome map
AA seq 475 aa AA seqDB search
MTLKRKKVVIVGGGITGLTTAYYLQQKTKAHNLPIDIVLIEASLRLGGKIHTVRQNGYII
ERGPESFFDTGSSVRKLARDLNIEHEMIQNNYGRTFIAVGSKLHQIPSNILLGGSPKILP
FMTSNVLSLMGKFRAAGDLLLPKLPHAADEPISEFFNRRFGKEVVENLVEPVLAGTFAGD
VDHLSMQSMFPQFYQLEKEYRSLLLGMKKTGKGIYALVDTPGELHYESFENGLESLIESL
EKALTDVTILKGLKVNSIEKNNDDTHLVELNDGTSIQADKIVVTTPFNVTKKIFPDSTTM
LKVPDMNYATIATVTMAFEKGSMQKYEDALNFFVSRNSHFAITSCTWSHRKWDNVSPDGQ
ELLRVYIGRVGDESIVELPDSEIEKIVLQDLERAVGLNAQPLLTTVARWKEAMPQYTIGH
ELRMSTMKEQFYQEFPNVLLTGSSYEGISIPDCVLQGRNTAEQLLSQFAESKVAM
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgactttaaaaaggaagaaggttgttatcgttggcggtgggatcactggtttaacgacg
gcatactatttacagcaaaaaacgaaggcgcataatttaccgatagatatcgtgttgatc
gaagcgtcactacgtttaggtggtaaaatccatactgtacgtcaaaatggatatattatc
gaacgtgggcctgaatcgttttttgatacaggtagcagtgtccgaaagttggcacgtgat
ttaaatatcgaacatgagatgattcaaaataattatggtcgaacatttatcgcagttggt
agcaagttacaccaaattccgagtaatattctgctcggagggtcacctaaaatcctcccg
tttatgacatcgaatgttctatctttaatggggaaattccgtgcagcaggagatttgttg
ttgccgaaattaccgcatgctgcagacgaaccgattagtgaatttttcaatcggcgcttt
ggtaaagaagtggtcgaaaatttagttgagccggtgttggcgggtacttttgcaggtgat
gtcgaccatcttagcatgcaatcgatgttcccgcagttttatcagttggaaaaagaatat
cgcagcttattgctcggtatgaaaaaaaccggaaaaggtatttacgcactcgtggatact
ccaggtgaactacattacgaatcatttgaaaatggattggaatccttaattgaatcattg
gaaaaagctttaaccgatgtaacgattttaaaaggattgaaagtgaattccattgaaaaa
aataatgatgatacccatcttgtagaattgaatgatgggacgtcgattcaagcagataaa
atcgtcgtgacgacaccgtttaatgtaacgaaaaaaatcttcccggactcaacgacaatg
ctgaaagttccggatatgaattatgccacaattgccacggttacgatggcatttgaaaaa
ggttcaatgcagaaatatgaagatgcacttaatttcttcgtttcacgcaatagtcatttt
gcaattacaagctgtacgtggagtcaccggaaatgggataatgtgtcaccggatggccag
gaactacttagagtgtacattggccgtgtaggggacgaatcgattgtagagctgcccgac
agtgaaattgaaaaaattgtattgcaagatttagagcgggcagtgggattgaatgcccag
ccgctactgacaacagttgcccgctggaaagaagcaatgcctcaatatacaattggtcat
gaattgcgcatgtctactatgaaagaacaattttatcaagagtttccgaatgtcttgtta
acaggaagctcctatgagggaattagtattccggactgtgtattgcaagggagaaatact
gccgagcaattactcagccagtttgccgagtcaaaagtagcaatgtaa

DBGET integrated database retrieval system