KEGG   Solibacillus silvestris StLB046: SSIL_0738Help
Entry
SSIL_0738         CDS       T02162                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00340  Histidine metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01230  Biosynthesis of amino acids
Module
siv_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SSIL_0738 (hisD)
Enzymes [BR:siv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SSIL_0738 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: BAK15161
UniProt: F2F051
Position
811085..812365
Genome map
AA seq 426 aa AA seqDB search
MKITILDNDISLKRQLEQGNEQQLQTVREVIQDVRTKGDAAIKYYSEKWDGFAPENLRVA
ECEIIEAVKSFDPQLYGDLQEAADNIYRYHNEQKRTGFQLPLEDGSYLGQRITPLDAVGL
YVPGGSAAYPSSVLMNVIPAQVAGVKRIVITSPAGNDGKLPDAVLVAAHILGVTEIYKVG
GAQAIAALAYGTETIAPVDKITGPGNIFVALAKREVFGEVAIDMIAGPSEICILADESAY
ADEIAADLLSQAEHDALACAVLITTSDDLADAVADQVEIQLSKLPRQAIARKSIENFGHI
YVAESMKDAVRAVNSLAPEHLEVITENAEKVSGMITHAGAIFIGRYSSEPVGDYFAGTNH
VLPTNSTARFASGLNVDDFIKRTSVVYYSEKTWQQNAPKIARLARLEGLEGHARAVESRG
WDKGEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaattttggataacgatatttctttaaaacgccaactcgagcaaggcaat
gaacaacagcttcaaacggtacgtgaagtcattcaggatgtacgtacgaaaggtgatgcg
gcgattaaatattatagtgaaaaatgggacggttttgcgcctgaaaacttacgcgtagcc
gaatgtgaaatcatcgaagcggttaaaagttttgatccgcaattatacggcgatttacaa
gaagcagcagataatatttatcgttatcataatgaacaaaaacgtacgggcttccagttg
ccgttagaagacggttcgtatttagggcaacgaattacaccgcttgatgcagtagggtta
tatgtacctggcggatcagcagcttatccatcttctgtattaatgaatgtcatcccggca
caagttgcgggagtgaaacgcattgtcattacatcacctgcaggaaatgacgggaaattg
ccggacgctgtacttgttgcggcccatattttaggtgtgacggaaatttataaagtaggc
ggtgcacaggcaattgcagcactagcttacggaacggaaacgattgcccctgtcgataaa
attacaggtccgggaaatatatttgtagcattggcaaagcgtgaagtattcggtgaggtg
gccattgatatgattgccggcccatctgaaatttgtattttagcggatgaaagtgcctat
gccgatgaaattgctgcagatcttctgtcacaggcagagcatgatgcattagcatgtgct
gtactgatcacaacaagtgatgatttggcagatgcagtggcagatcaagtcgagattcaa
ttgtcaaaattaccgcgacaggcgattgcgcgaaaatcgattgaaaacttcggtcatatt
tacgtagcagaatctatgaaggatgctgtacgtgctgtcaattcattggcacctgaacat
ttggaagtcattacagaaaatgctgaaaaggtttcgggaatgattacgcatgcgggtgcg
atttttatcggccgctatagttcggagccggtaggggattactttgcaggcacgaatcat
gtattaccgacaaactcaacagcgcgctttgcaagtggcttaaatgtcgatgattttatt
aaacgcacgagcgttgtttattatagcgaaaaaacttggcaacaaaatgcgccgaagatt
gcgcgtcttgcacgactggaagggttggaaggacatgcaagagcggtagaatcgcgcggc
tgggataaaggagaagaataa

DBGET integrated database retrieval system