KEGG   Solibacillus silvestris: SSIL_0775Help
Entry
SSIL_0775         CDS       T02162                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
siv  Solibacillus silvestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_0775
   01230 Biosynthesis of amino acids
    SSIL_0775
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_0775
   00051 Fructose and mannose metabolism
    SSIL_0775
   00562 Inositol phosphate metabolism
    SSIL_0775
Enzymes [BR:siv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SSIL_0775
Exosome [BR:siv04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SSIL_0775
  Exosomal proteins of bladder cancer cells
   SSIL_0775
  Exosomal proteins of melanoma cells
   SSIL_0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850777..851538
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMYKSFDEAVDFIEEIQQEIPSTDKVDAVICAPALYLPTLVVGAEDSSLA
IGAQNMHFEDEGAFTGEISPKMLSNVNVDYVILGHSERRELFNETDEAINKKVRAALNYG
IVPIICCGETLEEREAGQTEAKVARQITKALKDFAPIEVEHMVIAYEPIWAIGTGKTATA
EDANTVCCAIRLAVETLYGKDTAEKVRIQYGGSVKPENIEELLSQEHIDGALVGGASLQP
ASFMKLLEAAANA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgatcatagcaggaaactggaaaatgtataagtcctttgatgaggcagtt
gattttatcgaagaaatccaacaagagattccttctacggataaagttgatgcggtcatc
tgtgcacctgcgttatatttaccgacacttgtcgtaggggcagaagattcaagcctggca
attggcgcgcaaaacatgcactttgaagacgaaggagcatttacaggcgagatcagcccg
aaaatgctttcgaatgtcaatgtcgattatgtcattttagggcattcggagcgtcgtgag
ctattcaatgaaacagacgaagcgatcaacaaaaaagtccgtgctgctcttaattacggt
attgtaccgattatttgctgcggcgaaacattggaagagcgtgaagcgggtcaaaccgaa
gcaaaagtagcacgccaaattacaaaagcgttaaaagactttgctccaattgaagttgag
catatggtcattgcgtatgaaccaatctgggcaatcggaacagggaaaacagctactgcg
gaagatgcgaatacagtatgctgtgcaatccgtctggcggttgaaacattatacggaaaa
gatacagctgaaaaagtgcgcattcaatacggtggcagtgtaaagcctgagaacattgaa
gagcttttatcacaagaacatatcgatggcgcattagtaggaggagcaagcctacaacca
gcatcattcatgaaattattggaggcggcagcaaatgcctaa

DBGET integrated database retrieval system