KEGG   Solibacillus silvestris: SSIL_0796Help
Entry
SSIL_0796         CDS       T02162                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
siv  Solibacillus silvestris
Brite
Enzymes [BR:siv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SSIL_0796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
872427..873173
Genome map
AA seq 248 aa AA seqDB search
MKSALSSPFFFQAGPRAVLLLHGFTGSSADVRMLGRFLEKHGYTSLAPHYKGHGVPPEEL
IVSNPDEWWQDVKNGYTQLQEAGYEEIAVAGLSLGGVFSLKLATSHPVKGVVTMCSPMTM
RTTDIMFEGVLEYAKQYKKQQGKNEQEIELEIEAIKQQGMASLPELQQLIYDVRETIDLL
YAPILVIQSRNDKVINPDSANIIYDTVESIDKKISWYEHSGHVITLDKEKDQLHEEVLTF
LNSLDWIV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagctttgtcttcaccgttcttctttcaggcagggccgagagcggtactatta
ttacatggttttacagggagttcggcagatgtgcggatgcttggacgctttttggaaaag
cacggctacacatcgcttgccccacattataaaggacatggtgttccgccagaagaactc
attgtctcaaatcccgatgaatggtggcaagatgtaaaaaacgggtatactcaattacag
gaggcaggctatgaagaaatcgccgttgcaggactatcgctcggtggcgtattttcactc
aagcttgcgacaagtcatccggtaaaaggcgttgtcacaatgtgctcgccgatgacgatg
cgcacgacagacattatgtttgaaggcgtacttgaatatgcaaaacaatataaaaaacaa
caaggtaaaaatgaacaggaaattgaattagagattgaagcaatcaagcagcagggaatg
gcatcactgccagaactgcagcaattaatttacgatgtacgagagacaatcgacttacta
tatgcgccgattttggtgatccaatcgcgcaatgataaagtcatcaaccccgattctgcc
aatattatttatgataccgtcgaatcgattgacaaaaaaatcagctggtatgagcattcg
ggccacgtcatcacactcgacaaagaaaaagaccagcttcatgaagaagttctcacgttt
ttaaattcgttagattggatagtctaa

DBGET integrated database retrieval system