KEGG   Solibacillus silvestris: SSIL_1124Help
Entry
SSIL_1124         CDS       T02162                                 

Definition
acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
siv  Solibacillus silvestris
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:siv01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:siv00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1227576..1228970
Genome map
AA seq 464 aa AA seqDB search
MDWLQLAQERKEELIKELQQLIQIESVKDENNFSDIMPFGAGPKAALEFMLQKGVEQGMT
TKNVDHMAGHIEMGQGEELVGVLCHVDVVPAGNVASWTYPPFEGQVADGKLFGRGAIDDK
GPTMAAWLAMKLIHDAKIPLKKRVRMIIGTDEESGFQCVTRYFEKEEMPTIGFAPDADFP
LINAEKGIAHLTFSSKEKRSSDEQLLSFYAGNRTNMVPDEATATLKYAEKSTNENFLKYL
KENDVEGTFTKNDNGIIIVLKGKSAHAMEPEKGRNAAVYLAKFLQNVVTTNQSKSFVDFI
VRVFDNDHYGTALDFQFEDAMSGPTTLNPGIVTFDERGSSIEVSMRYSVTYPFEEKITKV
QALLQHEAFTLDVVSNSIPHYVSEEDELIQTLLQVYRKYSNDFSKPLSTGGGTYARVMKK
GVAFGMLFPGEQDVAHQADEFVDIENLIKATAIYAEAIVNLATN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggattggttacaactggctcaggaaagaaaagaagagcttataaaagaattgcagcaa
ttgattcaaatagaaagtgtaaaagatgaaaataatttttctgatataatgcctttcggt
gctggtccgaaagcagcattggaatttatgcttcaaaaaggtgtggagcaagggatgact
acaaaaaacgtggatcatatggccggccatattgaaatgggccaaggtgaagaacttgtc
ggtgtgctttgccatgtcgatgttgtacctgccggaaatgtcgctagttggacgtatcct
ccgtttgaagggcaagtggcagatggaaaattatttggtcgtggtgcgattgatgacaaa
ggtccaacaatggcggcttggctggcgatgaaactgattcacgatgcgaaaatccctttg
aaaaaacgagtacgaatgataattggtacagatgaagaaagcggtttccaatgcgtgacg
cgctacttcgaaaaagaagaaatgccgacaattggttttgcacctgatgcagactttccg
ctaatcaacgctgaaaaaggtattgcccatttaacgttttcaagtaaagaaaaacgatca
agcgatgagcaattactgtcattctatgcaggtaaccgaacaaatatggtgccggatgaa
gcaactgctactttaaaatatgccgaaaagagcacaaatgagaattttctgaaatattta
aaagaaaatgacgttgaaggtactttcactaaaaacgataatgggattataattgttttg
aaaggtaaatcagcccatgcaatggaaccggaaaaaggacgaaatgcagcggtttattta
gcgaagtttttacaaaatgttgtgacgacaaatcagagtaagtcgtttgtcgattttatt
gtccgtgtttttgacaacgatcattacggcacagcattggacttccaatttgaagatgcg
atgtcaggaccgacaacattaaatccgggaatcgtaacttttgatgagcgcggttcgtca
attgaagtaagtatgcgctattccgtgacatatccgtttgaagaaaaaataacgaaagta
caggcattattacagcatgaagcttttacgttagatgtagtgagcaattcaatcccgcat
tatgtaagcgaggaagatgaattgatacaaacattgctccaagtttatcgcaaatacagc
aatgatttctcgaagcctctttcaacaggcggagggacatatgcgcgcgttatgaaaaaa
ggggtcgcattcggcatgctgttccctggtgaacaggatgttgcccatcaggcagatgaa
tttgttgatattgaaaacttgataaaagcgactgccatttatgcagaagcaattgtaaat
ttagcaactaactaa

DBGET integrated database retrieval system