KEGG   Solibacillus silvestris StLB046: SSIL_1146Help
Entry
SSIL_1146         CDS       T02162                                 

Definition
(GenBank) acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siv  Solibacillus silvestris StLB046
Pathway
siv00010  Glycolysis / Gluconeogenesis
siv00620  Pyruvate metabolism
siv00640  Propanoate metabolism
siv00680  Methane metabolism
siv01100  Metabolic pathways
siv01110  Biosynthesis of secondary metabolites
siv01120  Microbial metabolism in diverse environments
siv01130  Biosynthesis of antibiotics
siv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_1146
   00620 Pyruvate metabolism
    SSIL_1146
   00640 Propanoate metabolism
    SSIL_1146
  Energy metabolism
   00680 Methane metabolism
    SSIL_1146
Enzymes [BR:siv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSIL_1146
Lipid biosynthesis proteins [BR:siv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSIL_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N NCBP3
Motif
Other DBs
NCBI-ProteinID: BAK15569
UniProt: F2F8U2
Position
1251912..1253639
Genome map
AA seq 575 aa AA seqDB search
MGMKTMEKLAVIPGEHNLKNYEDTAANHDWQHSEQAFSWFETGKVNIAYEAIDRHATTHR
KNKVALYYNDGNRKETYSFYDMKRHSNKAANVLKEKAELNKGDRVFIFMPRTPELYFSLI
GALKIGAIVGPLFEAFMEGAVYDRLMDSEAKVIITTPALLSRVPLEKLPHLKTVFVVGEN
IEETDKILDFNKYFAEASQDFDIEWVDKEDGSILHYTSGSTGAPKGVLQVHYAMVQQYQT
AQWVLDLKEDDIYWCTADPGWVTGTAYGIFGPWLNGVTNVVVGGRFSPQAWYGAIEEYGV
TVWYSAPTAFRMLMGAGPNIIGKYNLSTLRHVLSVGEPLNPEVVKWGLEILNHRIHDTWW
MTETGGHMICNYPSMEIKPGSMGKPVPGIYATIVDDQGNEVPPYTMGNLAIKKGWPAMMR
QIWGNPDRYESYFLKGEWYVSGDSAFMDEEGYFWFQGRVDDVIMTAGERVGPFEVESKLL
EHPDVVEAGVIGKPDPVRGEIIKAFISLREGVEPSEVLEANIRDFVKTGLSAHSAPREIE
FRDKLPKTRSGKIMRRVLKAWELDLPAGDLSTMEE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgaaaacgatggaaaagctagcagttattccaggggaacataatttgaaaaat
tatgaggatacagctgcaaatcatgattggcaacatagtgaacaagcattttcttggttt
gaaacggggaaagtcaatattgcgtatgaggcaatagaccgacatgcaacaacacaccgc
aaaaacaaagtggctctttattataatgatgggaaccgaaaagagacatattctttttat
gatatgaaacgtcattcgaataaagcggcgaatgtgttgaaagaaaaggcggaattaaat
aaaggcgatcgtgtttttatttttatgcctcgtacgccggagctctatttcagcttaatt
ggtgcattgaaaattggcgcgatagttggtccgttattcgaagcgtttatggaaggtgcc
gtatatgaccggttaatggatagtgaggcgaaagtgatcattacaacgcctgcactgttg
agcagagtgccgctggaaaagctgccgcatttaaagacggtatttgtagtcggggaaaat
attgaagaaacggataagatcttagattttaataaatactttgcagaggcatctcaggat
tttgacattgaatgggtcgataaagaagatggctccattttgcattatacatccggatca
acaggtgctccaaaaggggtattgcaagtccattatgcaatggttcagcaataccagaca
gcacagtgggtattggatttaaaggaagacgatatttactggtgcacagcggatcccgga
tgggtgactggaacagcttacggcattttcggtccatggctaaatggggtgacaaatgtc
gttgtaggggggcgcttcagtccgcaagcatggtatggggcaattgaagaatatggcgtc
acggtatggtatagtgcgccaactgcatttcgtatgttgatgggggcaggtccgaatatt
atcggtaaatataatctttctacgcttcgtcatgttttatcggtcggtgaaccattaaat
ccggaagttgtgaagtggggattggagattttgaaccatcgtattcacgatacatggtgg
atgacggaaacaggtggccatatgatctgcaactacccatcgatggagattaagccaggc
tcaatgggcaaacctgtgccgggaatttatgcaacgattgtagatgaccaaggcaatgaa
gtgccgccgtatacgatggggaatttggcgatcaaaaaagggtggcctgcaatgatgcgt
caaatatggggaaatcctgatcggtatgaatcttattttttaaaaggagaatggtatgtt
tcaggagattctgcatttatggatgaggaaggttatttctggttccaaggtcgtgtagac
gatgtgattatgacagcgggagagcgagttggaccatttgaagtggaaagtaaactgctt
gaacatcctgatgtagtggaagcaggcgtaattggaaaacctgatccggtccgcggcgaa
attattaaggcatttatatcgttacgtgaaggggtagagccgagtgaagtgcttgaagcg
aatattcgagactttgtaaaaacagggttatcggctcattcagcaccacgtgaaattgaa
ttcagagataagttgcctaaaacccgaagcggaaagattatgcgtcgtgtactaaaggct
tgggaacttgacttgcctgcaggcgatttatcaacaatggaagagtaa

DBGET integrated database retrieval system