KEGG   Solibacillus silvestris: SSIL_1164Help
Entry
SSIL_1164         CDS       T02162                                 

Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siv  Solibacillus silvestris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:siv01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:siv00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:siv00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:siv00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:siv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274363..1275925
Genome map
AA seq 520 aa AA seqDB search
MNENQLVAPEIYNIVNEFEKHDNKESKTALIFQEENGHQERYTYEELLQRANQAANAFYA
QGLKKGDVILIMLPRCLEAYVSYIGALKAGLVIIPSSELLRAKDIDYRLNHSEAKAIIVM
EQFVNEFEHVENLANVECFIVGKEKEGWTSLMALAEQQSNEFDSVETTAHDLAFLAYTSG
TTGNPKAVMHSHGWGYAHLRTTAAEWLGVRDGDTVWATAAPGWQKWIWSPFLAVLGSGAT
GFVYKGKFDPKQFLHLIEQQHINVLCCTPTEYRMMAKLDQLNTFNLTSLRSAVSAGEPLN
REVIETFEREHQLTVRDGYGQTENTLLIGTLLNMELRPGSMGKPTPGNIIDLINEDGEPV
PAGEVGDIAVHKSTPALFKGYYKDPERTAIQYRGDWYVTGDRAIKDEDGYFWFEGRNDDI
IISSGYTIGPFEVEDALTKHPAVQECAVVASPDEIRGNVVKAFVVLKDVTLKESPTIVED
LQNHVKQLTAPYKYPRIIEFLDELPKTISGKIRRVELRVK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaatcaattagttgcaccggaaatttataatattgtgaatgaatttgaaaaa
cacgataataaagaatcgaaaacagcgttaatttttcaagaagaaaatggacaccaagag
cgttatacatacgaagagttactacaaagagcaaatcaggcagcgaatgccttttatgca
caaggactaaaaaaaggtgatgtcattttaattatgctgcctcgctgtttagaagcatat
gtttcttatattggggcattaaaagcaggattggtcattattccaagttcggagttgctg
cgagctaaagatattgattatcgactaaatcattctgaggctaaggcgattatcgtgatg
gaacaattcgtaaatgaatttgaacatgtagaaaatttagcgaatgtagaatgctttatt
gtcggaaaagaaaaagaaggatggacttcattaatggcgcttgcagagcaacagtcaaac
gagttcgattctgttgagacgacagcacatgatcttgcttttttagcctatacatcaggc
acaacaggaaatcctaaagctgtaatgcactcacatggctggggatatgcacatttacgt
acaacggctgcggagtggcttggcgtacgtgatggtgatacggtatgggcaactgcagct
cctggatggcaaaaatggatttggagtccgtttcttgctgtattaggcagtggcgcaaca
ggatttgtatataaagggaagtttgaccctaaacagtttttacatttaatagagcagcaa
cacatcaatgtgctttgctgtacaccgacagaatatcgaatgatggcgaagttagatcag
ttaaatacatttaatttaacttcattgcgcagcgctgtctcggcaggtgagccattaaac
cgtgaagtaattgaaacgttcgaacgtgaacatcagttaactgtccgtgatggctatggc
caaacagaaaatacattattgatcggaacattgttaaacatggaattgcgtcccggctcc
atggggaaaccgactccgggaaatatcattgatttaatcaatgaagatggtgagcctgtc
ccggcaggtgaagttggtgatatcgcagtacacaaatcgacacctgcactatttaaaggg
tattataaagatcctgaacgtacagcgattcaatatcgcggggattggtatgtaacaggc
gaccgagcgataaaggatgaagacggttatttctggtttgaaggccgtaatgatgacata
attatttcatcaggttatacaattgggccgtttgaagttgaggatgctttaacgaagcac
cctgctgtacaggaatgtgctgttgttgcaagtccggatgaaattcgagggaatgttgta
aaagcatttgtcgtccttaaagatgttacattaaaagaaagcccaacaattgtagaagat
ctgcaaaatcatgtaaaacagctgacagcaccatataaatatcctcgaattatagagttt
ttagatgaattacctaaaacaatttcagggaaaatccgtcgtgttgaattgcgtgtaaag
taa

DBGET integrated database retrieval system