KEGG   Solibacillus silvestris: SSIL_1164Help
Entry
SSIL_1164         CDS       T02162                                 

Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
siv  Solibacillus silvestris
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:siv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SSIL_1164
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSIL_1164
   00620 Pyruvate metabolism
    SSIL_1164
   00640 Propanoate metabolism
    SSIL_1164
  Energy metabolism
   00680 Methane metabolism
    SSIL_1164
Enzymes [BR:siv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SSIL_1164
Lipid biosynthesis proteins [BR:siv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SSIL_1164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1274363..1275925
Genome map
AA seq 520 aa AA seqDB search
MNENQLVAPEIYNIVNEFEKHDNKESKTALIFQEENGHQERYTYEELLQRANQAANAFYA
QGLKKGDVILIMLPRCLEAYVSYIGALKAGLVIIPSSELLRAKDIDYRLNHSEAKAIIVM
EQFVNEFEHVENLANVECFIVGKEKEGWTSLMALAEQQSNEFDSVETTAHDLAFLAYTSG
TTGNPKAVMHSHGWGYAHLRTTAAEWLGVRDGDTVWATAAPGWQKWIWSPFLAVLGSGAT
GFVYKGKFDPKQFLHLIEQQHINVLCCTPTEYRMMAKLDQLNTFNLTSLRSAVSAGEPLN
REVIETFEREHQLTVRDGYGQTENTLLIGTLLNMELRPGSMGKPTPGNIIDLINEDGEPV
PAGEVGDIAVHKSTPALFKGYYKDPERTAIQYRGDWYVTGDRAIKDEDGYFWFEGRNDDI
IISSGYTIGPFEVEDALTKHPAVQECAVVASPDEIRGNVVKAFVVLKDVTLKESPTIVED
LQNHVKQLTAPYKYPRIIEFLDELPKTISGKIRRVELRVK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaatcaattagttgcaccggaaatttataatattgtgaatgaatttgaaaaa
cacgataataaagaatcgaaaacagcgttaatttttcaagaagaaaatggacaccaagag
cgttatacatacgaagagttactacaaagagcaaatcaggcagcgaatgccttttatgca
caaggactaaaaaaaggtgatgtcattttaattatgctgcctcgctgtttagaagcatat
gtttcttatattggggcattaaaagcaggattggtcattattccaagttcggagttgctg
cgagctaaagatattgattatcgactaaatcattctgaggctaaggcgattatcgtgatg
gaacaattcgtaaatgaatttgaacatgtagaaaatttagcgaatgtagaatgctttatt
gtcggaaaagaaaaagaaggatggacttcattaatggcgcttgcagagcaacagtcaaac
gagttcgattctgttgagacgacagcacatgatcttgcttttttagcctatacatcaggc
acaacaggaaatcctaaagctgtaatgcactcacatggctggggatatgcacatttacgt
acaacggctgcggagtggcttggcgtacgtgatggtgatacggtatgggcaactgcagct
cctggatggcaaaaatggatttggagtccgtttcttgctgtattaggcagtggcgcaaca
ggatttgtatataaagggaagtttgaccctaaacagtttttacatttaatagagcagcaa
cacatcaatgtgctttgctgtacaccgacagaatatcgaatgatggcgaagttagatcag
ttaaatacatttaatttaacttcattgcgcagcgctgtctcggcaggtgagccattaaac
cgtgaagtaattgaaacgttcgaacgtgaacatcagttaactgtccgtgatggctatggc
caaacagaaaatacattattgatcggaacattgttaaacatggaattgcgtcccggctcc
atggggaaaccgactccgggaaatatcattgatttaatcaatgaagatggtgagcctgtc
ccggcaggtgaagttggtgatatcgcagtacacaaatcgacacctgcactatttaaaggg
tattataaagatcctgaacgtacagcgattcaatatcgcggggattggtatgtaacaggc
gaccgagcgataaaggatgaagacggttatttctggtttgaaggccgtaatgatgacata
attatttcatcaggttatacaattgggccgtttgaagttgaggatgctttaacgaagcac
cctgctgtacaggaatgtgctgttgttgcaagtccggatgaaattcgagggaatgttgta
aaagcatttgtcgtccttaaagatgttacattaaaagaaagcccaacaattgtagaagat
ctgcaaaatcatgtaaaacagctgacagcaccatataaatatcctcgaattatagagttt
ttagatgaattacctaaaacaatttcagggaaaatccgtcgtgttgaattgcgtgtaaag
taa

DBGET integrated database retrieval system